KEGG   Brevibacillus brevis: BBR47_24350
Entry
BBR47_24350       CDS       T00879                                 

Gene name
ansA
Definition
(GenBank) L-asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00250  Alanine, aspartate and glutamate metabolism
bbe00460  Cyanoamino acid metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBR47_24350 (ansA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BBR47_24350 (ansA)
Enzymes [BR:bbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     BBR47_24350 (ansA)
SSDB
Motif
Pfam: Asparaginase Asparaginase_C
Other DBs
NCBI-ProteinID: BAH43412
UniProt: C0ZCA3
Position
complement(2516436..2517407)
AA seq 323 aa
MSKKILVVNTGGTIAMSVDDSEGVKPLDDQAVNKILPFLEKHADVTMKNVLNLPSPHMTP
AIMNQLRLDIEEAFEQDHYDGIVITHGTDTLEETAYFLDLTLSVNVPIVVTGAMRSSNEL
GADGPVNLISSVRVAADSDSLNKGVIVVFNDEIHAARHVTKTHTSNVATFQSPQYGPIGT
IAKKSVQYHHAPLDREHYAITHADANVPLIKAVAGMEPSWLQFLLEQQIDGLVVEAFGLG
NLPPAIIPTLQQLLDKGVPIVLVSRCYNGQVQDIYDYEGGGRKLKEMGIIFSNGLNGQKA
RLKLIVTLQKTRTFKELQLLFDQ
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtcaaaaaaaattttggtagtgaacacaggcggtacaattgccatgtctgtcgatgac
tcagaaggcgtaaagccattggatgatcaagcagtcaacaaaatccttccttttttagaa
aaacacgcggatgtcaccatgaaaaatgtactcaacctacctagccctcatatgactcct
gcgatcatgaatcagctgcgtctcgatattgaggaagcctttgaacaagatcattatgat
ggcatcgtcattacccatgggactgatacgttggaggagaccgcatacttcctggatctg
actttgtcggtcaacgtcccgattgtcgtaaccggcgccatgcgcagcagtaatgagctc
ggagctgacgggccagtcaatctcatttcttccgttcgtgtagctgcagattccgacagt
ttgaacaaaggggttatcgttgtttttaatgacgaaattcacgcggcacgtcacgtaacg
aaaacacacacgagcaatgtcgctaccttccagtcgccacaatacggaccgattggaacc
attgcgaaaaaaagcgtgcaataccaccacgctccattggatcgcgagcattatgccatt
acccatgctgatgcgaatgtcccgttgatcaaggcagttgctggcatggagccttcttgg
ctacagtttttattggagcagcaaattgatggactcgtggtagaggcgtttggattggga
aatcttccacccgctatcatccctaccctgcagcaattactggacaaaggcgtaccgatc
gtcctcgtctctcgctgctacaatggccaggtgcaggatatctatgactatgaaggtgga
ggccgcaagctaaaagagatgggcatcatcttctccaatggcttaaatgggcaaaaggct
cgtctcaagctaattgtaacgctgcaaaaaacacggactttcaaagagctgcagctgttg
ttcgaccagtaa

DBGET integrated database retrieval system