KEGG   Brevibacillus brevis: BBR47_38390
Entry
BBR47_38390       CDS       T00879                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00471  D-Glutamine and D-glutamate metabolism
bbe00550  Peptidoglycan biosynthesis
bbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BBR47_38390 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBR47_38390 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbe01011]
    BBR47_38390 (murD)
Enzymes [BR:bbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BBR47_38390 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:bbe01011]
 Precursor biosynthesis
  Amino acid ligase
   BBR47_38390 (murD)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C TrkA_N Pyr_redox Mur_ligase NAD_binding_7 XdhC_C Pyr_redox_3
Other DBs
NCBI-ProteinID: BAH44816
UniProt: C0ZGA7
Position
complement(4021389..4022753)
AA seq 454 aa
MMRFHNKHVVVIGMAKSGVAVAKLLHRFGAHVVVNDKKPREEAVGVEELESLGIPVICGY
HPDDLIHEGVSLVVKNPGIPYEAAPVKQAQALGIPVVTEVELASQIAKAPIIGITGSNGK
TTTTTLVGLIFKEAGLDAKVGGNIGTVLCGLAEEAGPDEWLVAELSSFQLMGTRKFRPHI
GVLLNLYPAHLDYHHTMEEYLAAKLKMFANQTADDAAILPYDQPEIVEKCKDLPASIYYF
SKSQEVPKGAFVKDGLILFADGNGNTEPIVAIADITVPHLDNALAAILVAKLAGADKQSI
IQVLTTFPGVEHRMEFVDSIRGVKYFNDSKATNPEAASRALQACKEPVVWICGGLDRGVD
FRELLPVIQGRVKAVIALGQTAPILLERAQEAGINERIHVDTVEKAVLAASQLAESGDVV
LLSPACASWDMFPSFETRGSMFKDGVHRLKTSLA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgatgcgttttcataataagcatgtcgtcgttattggtatggcaaagagcggtgtcgca
gtggcaaaactgctacaccgctttggtgctcatgtcgtcgtaaatgataaaaagccacgt
gaagaagcggtcggggtagaagagctggaatcgttggggattccggtcatttgtggttat
catcccgatgatctcattcatgaaggcgtatcccttgtggtcaaaaatccggggattccg
tatgaagcagcacccgtcaagcaggcgcaggcactcggcattcctgttgtgacggaggtg
gagctggcctcccagattgccaaggcaccgattatcggcattacaggctccaatggcaag
accacgactacgacgctcgtcggactgattttcaaagaagcgggtctggatgcgaaggta
ggaggcaacattgggaccgtattgtgcggcctagcggaggaagctggtcccgacgaatgg
ctcgttgctgaattgagtagcttccaactgatggggacgcggaagttccggccacatatc
ggtgttttgctcaatctgtatcctgctcatttggattaccatcacaccatggaagagtat
ttggcagccaaactgaaaatgtttgccaaccaaacggcagatgacgcagctattttgcca
tatgaccaaccagagatcgtagaaaaatgcaaagacctccctgcatccatctactacttt
agcaagagtcaagaggtgccaaaaggagcttttgtcaaggatggtttgatcctgtttgcg
gatgggaatgggaatacagagccaatcgttgcgatcgcggatattaccgttcctcatttg
gacaacgcactggcagcgattctggttgcgaagctcgcaggcgcggacaagcaatcgatt
atacaagttcttactaccttcccaggggtagagcaccggatggagttcgtggattcgatt
cgcggtgtcaaatacttcaatgattcaaaagcgactaacccggaagcggcatcccgcgct
ttgcaagcgtgcaaggagccagtcgtatggatttgcggtgggctggatcgtggtgttgat
tttcgggaactgctgcctgtgatccaaggtcgggtaaaagcagtcatcgctctcgggcaa
acggctccgattttactggaacgtgcgcaggaagcagggattaatgagcggatccatgtc
gatactgtggaaaaagccgttcttgctgcttcccagttggccgaatcaggtgatgtggtc
ttactgagccctgcttgtgcgagttgggacatgtttccttcgtttgagacaagggggagc
atgtttaaggacggcgtgcatagacttaaaacaagcctagcataa

DBGET integrated database retrieval system