KEGG   Borreliella burgdorferi B31: BB_0054
Entry
BB_0054           CDS       T00012                                 

Name
(GenBank) putative protein-export membrane protein SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu02024  Quorum sensing
bbu03060  Protein export
bbu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BB_0054
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BB_0054
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB_0054
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbu02044]
    BB_0054
Secretion system [BR:bbu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BB_0054
SSDB
Motif
Pfam: SecG 2TM Spore_III_AF Phage_holin_2_4 Phage_Gp23
Other DBs
NCBI-ProteinID: AAC66457
UniProt: O51083
Position
complement(50112..50474)
AA seq 120 aa
MDLVRFFIFIIFVIVSIFIILLVLIQDEQGDGIGGVFGGGSSSIFGAKSSSVAVKITGFF
IALFFIFVVLLSFLNTRRADDSFLNDIKTENKNSSTFWDDENSESDANINEIKENNLKEK
NT seq 363 nt   +upstreamnt  +downstreamnt
ttggatttagttagattttttatttttataatttttgttattgtttcgatttttattatc
cttttagttttaattcaagatgagcagggtgatggaataggtggtgtttttgggggtggt
agttcttctatttttggggcaaagtcttcaagtgttgctgtaaaaattactggatttttt
atagcactcttttttatctttgtagttttgttatcttttctaaacaccagaagagcagat
gatagctttctaaatgacataaagactgaaaacaagaatagttcaactttctgggatgat
gagaatagtgaatcagatgctaatattaatgaaattaaagaaaacaatttgaaagaaaaa
taa

DBGET integrated database retrieval system