KEGG   Borreliella burgdorferi B31: BB_0076
Entry
BB_0076           CDS       T00012                                 

Symbol
ftsY
Name
(GenBank) signal recognition particle-docking protein FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu02024  Quorum sensing
bbu03060  Protein export
bbu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BB_0076 (ftsY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BB_0076 (ftsY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB_0076 (ftsY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbu02044]
    BB_0076 (ftsY)
Secretion system [BR:bbu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BB_0076 (ftsY)
SSDB
Motif
Pfam: SRP54 SRP54_N ALIX_LYPXL_bnd AAA_30 AAA_22 AAA YqeC AAA_24 AAA_14 CbiA ABC_tran Thymidylate_kin AAA_16 Zeta_toxin AAA_17 AAA_19 NTPase_1 DUF815 HMW1C_N AAA_33 MeaB NACHT
Other DBs
NCBI-ProteinID: AAC66458
UniProt: O51103
Position
72647..73492
AA seq 281 aa
MGILEKIKNLFKSKQQENVIENLEDILLESDINNEIVIEIINKLTKEKNENEKTIIGKLK
ELLSSYINTKKFTLENNKLNILLIVGINGIGKTSSIAKLANKLKNEGKNILISAADTFRA
AAIEQMKIYGEQIGVRIISQNQGSDPSAVIFDSISSAKLKNYDALIIDTAGRLQNKENLI
KELQKINNVILKQIKNTDINYQKILVIDSTIGKNANSQAEIFNKAIEIDGIIITKLDSSS
KAGTILNISKILEKPIYFTTFGEKLEDIKEFDINEYFNKLL
NT seq 846 nt   +upstreamnt  +downstreamnt
ttgggcattttagaaaaaataaaaaatttatttaaaagcaaacaacaagaaaatgttatt
gaaaatttagaagacattttattagaatcagacattaataatgaaattgtaatagaaata
ataaataaattaacaaaagaaaaaaatgaaaacgaaaaaactattattggaaaactaaaa
gaacttttaagcagctatattaatacaaaaaaatttactctagaaaataacaaattaaat
attttgttaatagttggtataaatggaattggaaaaacatcaagcatagcaaaacttgca
aataaattaaaaaatgaaggcaaaaatatattaatatcggctgctgatacattcagagca
gctgcaattgaacaaatgaaaatttatggagaacaaatcggtgttagaataatatctcaa
aaccaaggaagcgatccatcagctgtgatattcgacagcatatcaagcgctaagcttaaa
aattacgatgcattaattattgacacagccggaagattgcaaaataaagaaaatttaata
aaagagcttcaaaaaataaacaatgtaatattaaagcaaataaaaaacaccgacatcaat
taccaaaaaatacttgtaatagattctactattggaaaaaatgcaaatagtcaagcagaa
atttttaataaagcaatagaaatagacggaataataatcacaaaacttgattcatcctca
aaggcaggtacaatactaaatatttcaaaaattcttgaaaaacctatatactttactacc
tttggagaaaaactagaagatattaaagaatttgatataaatgaatattttaataaatta
ctatga

DBGET integrated database retrieval system