KEGG   Borreliella burgdorferi B31: BB_0154
Entry
BB_0154           CDS       T00012                                 

Symbol
secA
Name
(GenBank) preprotein translocase, SecA subunit
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu02024  Quorum sensing
bbu03060  Protein export
bbu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BB_0154 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BB_0154 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB_0154 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbu02044]
    BB_0154 (secA)
Enzymes [BR:bbu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BB_0154 (secA)
Secretion system [BR:bbu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BB_0154 (secA)
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD Helicase_C ResIII
Other DBs
NCBI-ProteinID: AAC66536
UniProt: O07497
Position
complement(153701..156400)
AA seq 899 aa
MLKAVLETTIGSKSKRDLKDYLPTLRNINKLERWALLLADEDFSKETEKLKDELKSGNSL
ENILERAFTLSREAARRRLKERPYDVQIIAGLALHKGKIIEMKTGEGKTLSSVQAAYLNS
LTGDGVIIVTVNDYLAERDSNWMKPVFDLLGVSVGVVLSNMDYELRKAQYAKDITYVTNN
ELGFDYLRDNMRYDLNEKSLRKFNYCIIDEIDSILIDEARTPLIISGPTEGNTNAYLEVN
SLVSFLKECSKDPKTGDYPLEIDDLDGDYTVDEKAKRISFTAKGLNNLEQLLVSKGIISG
SMYTDSNFNYVHYMTQALKAHLLFLKNREYIVGDSGVEIVDEFTGRVLTGRRYSDGLHQA
IEAKEGVRVANENKTMATITFQNLFRMFDKISGMTGTADTEAKEFHKIYNLDVVVVPTNR
LLARIDEDDTIYYTEEFKFNAITDEVYKTYKKGQPVLVGTVSIEKSEILSAMFKNRGIKH
EVLNAKNHSREAFIIAEAGAKHAVTIATNMAGRGTDIKLGGNIEHRVRKKIGTNVSLEEF
QEAVKNERENYLKDYNEVKSLGGLYVIGSERHESRRIDNQLRGRSGRQGDPGRSRFYVSL
EDDLMRLFAGDNLRSLMGKLGMATGEPITHSLLTKSLINAQKRVEDRNFEIRKHLLEYDD
VITKQRDFIYAQRNSILEDTAIKDRILVALEEYLSFLLEGTKSSTVSNVFLNEVNSIFAY
MLESLGSIENISSLDLKAKLMQIAKANLDEKENLIGRDLFNGFLRYEYLKNIDFKFQEHL
ANLDSLREAVYLRSYANKNPITEYKEEGFSIFSELIKDIKVSTIRRVLQLKLDSNSSDFK
STKKSRNVKPIHKELSGIVINENKSASNVQVVRSSPKIGRNEPCYCGSGKKYKNCHGKS
NT seq 2700 nt   +upstreamnt  +downstreamnt
atgttaaaagcagtacttgagacaactattggctcaaaaagtaaaagagatttaaaagat
tatcttccgactttaagaaatattaataagcttgagcgttgggcattattgttggcagat
gaagatttttcaaaggagacagaaaagcttaaagatgaattaaaatcgggtaattcttta
gagaatattttagagcgagcttttactctgtctagagaagctgctagaaggcgtcttaaa
gaaaggccttatgatgtgcaaatcattgcggggcttgctcttcacaaaggcaaaataata
gaaatgaaaacgggagaaggaaaaactctctcctcagttcaagcggcgtatttaaatagt
ttaacaggagatggggttattattgttactgttaatgactatcttgcagaacgtgattcc
aattggatgaagccggtttttgatcttttgggtgttagcgtgggggttgttctatctaat
atggattatgagctaagaaaggctcaatatgctaaagatattacttatgttacaaataat
gaacttggatttgattatctaagagataatatgcgttatgacttgaatgaaaaatccttg
agaaagtttaattattgtattattgatgaaattgattctattttgatcgatgaggcaaga
actccattgattatttcagggcctactgaaggcaacaccaatgcttatcttgaagttaat
tctcttgtatcttttttaaaagaatgttccaaggatcccaaaacaggtgattatccttta
gaaatagacgaccttgatggtgattatactgttgatgaaaaagccaaaagaatttctttt
actgccaaagggcttaataatcttgaacagcttttagtttctaaaggcattattagtggg
tctatgtataccgattcaaattttaattatgttcattatatgactcaagccttaaaagca
catttgctttttttaaaaaatagagagtatattgttggtgattctggggttgagattgta
gatgaatttactgggagagttttaacagggcgaagatattcagatggacttcaccaagct
attgaggctaaagaaggagttagagttgctaatgaaaataagactatggcaactattact
tttcaaaatttatttagaatgtttgataaaatttctggcatgacaggtacagctgataca
gaagctaaggaatttcataaaatatataatcttgatgtagttgtagttccaacaaataga
ttgttagcgcgaatagatgaggatgatactatttattatacggaagaatttaaatttaat
gcgattacagatgaggtttacaaaacttacaaaaaaggccaaccggttttagtgggaacc
gtttctattgaaaaatctgagattttatcagctatgtttaaaaacagagggattaagcat
gaagttcttaatgcaaaaaatcattctcgagaagcatttattattgctgaagctggagca
aaacatgcggttacaatagcaacaaatatggctggtcgtggtacggatattaagcttggg
ggaaatattgagcacagagttagaaaaaaaatcggaactaatgtaagccttgaagaattt
caagaggctgttaaaaatgagagagaaaattacctgaaagactataatgaggttaaaagt
cttggtgggctttatgttattggtagtgagcgtcacgaatcaaggcgaatagacaatcag
cttcgtgggcgtagtggaagacaaggtgaccctgggcgctcaagattttatgtgtccctt
gaggacgatttaatgcgcctttttgctggggacaacctaagatcattaatgggtaagctt
ggaatggcaacaggagagcctattacacattctcttttaactaaatctttgattaatgct
caaaaacgagtagaagacagaaattttgaaattagaaagcatttgttagagtatgacgat
gttattacaaaacaaagagattttatttatgctcagagaaactccattcttgaagataca
gctattaaggatcgtattcttgttgctttagaagaatatcttagttttttgcttgaaggg
acaaaaagtagcacggtttcaaatgtttttttaaatgaagtaaattcaatttttgcttat
atgcttgagagtcttggttctattgaaaatattagttctcttgatttaaaggctaagcta
atgcaaatagcaaaagcaaatttagatgaaaaggaaaatttgattggtagagatcttttt
aatggatttttaagatatgaatatttgaaaaatattgattttaaatttcaggaacatctt
gcaaatttagactctttaagagaggctgtttatttaaggtcttatgccaataaaaatcca
atcacagaatacaaagaagagggattttcaatatttagcgagcttattaaagatattaaa
gtttctaccataaggcgtgttcttcaattaaaattggatagcaattcttccgattttaag
tcaacaaagaagtctaggaatgttaaaccaattcataaagaactttctggaattgttatt
aatgagaataaaagcgcttctaatgttcaagtggttagaagttctcctaaaataggcaga
aatgagccttgttattgtggaagtgggaagaaatataaaaattgtcatggcaaaagttaa

DBGET integrated database retrieval system