KEGG   Borreliella burgdorferi B31: BB_0498
Entry
BB_0498           CDS       T00012                                 

Name
(GenBank) preprotein translocase, SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu02024  Quorum sensing
bbu03060  Protein export
bbu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BB_0498
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BB_0498
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB_0498
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbu02044]
    BB_0498
Secretion system [BR:bbu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BB_0498
SSDB
Motif
Pfam: SecY
Other DBs
NCBI-ProteinID: AAC66844
UniProt: O51451
Position
505554..506858
AA seq 434 aa
MKELFLSLFTVKDLRNKFLFTLFVLFLFRVGSYLPIPGIDSVALKSYFKSQSDFSIANYF
DFFSGGAFSNFSIFMLSIGPYISASIIVQLLVYSFPSLKKMQEGDGGRQKTKKYTKYLTI
VAAVVQGYATSLYAKGIPGAVTIPFYRYIFVAILTVTTGTFILLWFGEQINQRGVGNGTS
LIIFSGIVVRLQAALFNLFQSMQDPSQNVNPVFVILIISIFILVVILIIYEYKAQMRIAI
HYARANSNNTVSSYLPIKLNPSGVLPVIFASVLITLPLQILSGFAETSSIARQILSYLRP
NGFYYTFLNVILIIGFTYFYSKIQLSPKDISNNIRKNGGTIPGIKSDEMEKYLDEIMNKT
LFSGSIFLSIIAIIPFLVQNIFRFPHDVSRIMGGSSLLIMVGVALDTLIHIDAYLKTQGF
SHGNKKNYAFLQKI
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaaagaattgtttttaagtttatttaccgttaaggatttgagaaataagttcttgttt
actttatttgttctttttctttttagagttggttcatatttgccgataccaggaatagat
tctgtagctcttaaaagttatttcaagtcgcaatcagatttttcaattgctaattatttt
gattttttttcagggggagcttttagtaatttttctatatttatgcttagtatagggcct
tacatttcggcatctattattgttcagcttcttgtttattcttttccttctttgaaaaaa
atgcaagaaggtgacggcggaagacaaaagactaaaaaatatacaaaatatttaacaata
gttgcagctgtagttcaaggatacgcaacaagcctttatgctaaaggtattccgggtgct
gttaccattcccttttatagatatatatttgttgctattttaacggttactacggggaca
tttatccttttgtggtttggagagcaaattaatcaaagaggtgtaggtaatggaacatct
ttgataattttttctggcatagtggttagacttcaagcagctttgtttaacttattccaa
agcatgcaggatccttctcaaaatgttaatcctgtttttgttatacttattataagtata
tttattttagttgttatattgattatatatgaatataaggctcaaatgcgaattgccatt
cattatgctagagcaaattctaataatacagttagttcatatttgccaatcaagttgaat
ccatcgggcgttttgcctgttatttttgcctctgttttaattactctgcctttacaaatt
ttaagtggcttcgcagaaacttcttccatagccaggcaaattttatcttatttaaggcct
aatggtttttattatacttttttgaatgtaattttgataattggatttacgtatttttat
tctaagattcagttaagccctaaagacataagtaataatattcgtaagaatgggggcact
attccaggaataaagtctgatgagatggaaaaatatttagatgaaattatgaataaaact
ttattttcaggatctatttttttgtcaattattgcaattattccatttttagtgcaaaat
atttttagatttccacacgatgtttctagaataatgggggggtcttctttgcttattatg
gtaggggttgctcttgatacattaattcatattgatgcttatttgaaaactcaaggattt
tctcatggaaataaaaagaattatgcatttttgcaaaaaatttag

DBGET integrated database retrieval system