KEGG   Borreliella burgdorferi B31: BB_0651
Entry
BB_0651           CDS       T00012                                 

Symbol
yajC
Name
(GenBank) preprotein translocase, YajC subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu02024  Quorum sensing
bbu03060  Protein export
bbu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BB_0651 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BB_0651 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB_0651 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbu02044]
    BB_0651 (yajC)
Secretion system [BR:bbu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BB_0651 (yajC)
SSDB
Motif
Pfam: YajC TssO AgrB
Other DBs
NCBI-ProteinID: AAC66994
UniProt: O51595
Position
690482..690799
AA seq 105 aa
MYSMGGFVFLLQEFSGNSSFLRSLLVFVPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGD
KVLTIGGIFGVVKKLGDTDVILELSPNNEAVFIKNSIDKVLSEKK
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtatagtatgggaggttttgtgtttttattgcaagaatttagcggcaatagtagcttt
ttacgaagtttattagtttttgtgcctgttattgctatattttggtttttagtgatatct
cctcagcgtaaggaagagaagaataaaaaagaaatgataaaaaatctaaaaaagggcgat
aaggtattaacaataggtggaatttttggagttgtgaaaaaattaggcgatacggatgtt
attttagaattaagtccaaataacgaagcagtatttataaaaaactctattgataaagtt
ttgtctgaaaaaaaatga

DBGET integrated database retrieval system