KEGG   Borreliella burgdorferi B31: BB_0652
Entry
BB_0652           CDS       T00012                                 

Symbol
secD
Name
(GenBank) protein-export membrane protein SecD
  KO
K03072  preprotein translocase subunit SecD
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu03060  Protein export
bbu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BB_0652 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BB_0652 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbu02044]
    BB_0652 (secD)
Secretion system [BR:bbu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BB_0652 (secD)
SSDB
Motif
Pfam: SecD_SecF MMPL ACR_tran Sec_GG
Other DBs
NCBI-ProteinID: AAC66993
UniProt: O51596
Position
690885..692645
AA seq 586 aa
MKKGSKLILILLVTFFACLLIFPTLKWYFLMSVEDKKISSYSQEALRDYSKKKALNDLVK
LKELYNKDPNSSIPASLSYLIPIAKNNYRSSMKIPPNIFTAKTLREGFLTDSDMGEVSLE
IYRYYENIKKGKSRIIHLGLDLSGGMSVTISLDYSSVEKKLGRSLTFAEREDAIYRIMQI
LKDRVBRFGLTEPKIVREAGGNKIFLDIPGEKDESRVSTLLSGKGNLTFYVVDDESTSLL
HRKILEAGSLFSIPEIQASMNLPDSKQIFPWYVKDSYGVDDESSVRYYVVDASPENSFDG
AHIKDAGVSNDPRTGRDTVAFSLDVDGSEKFFKFTQKNVGKSLAVVMEGKIKSVAGIGYA
ITGGNVSIQGDSFDKKEAQDLALVFKTAAFPVDIKIDDLRIIGPTLGARTIDLGIKASAL
ALCLVFLFICVYYGLSGVVAGFSLVIYNVFLILAILSAFNFTLTLTSIAGLILTMGMAVD
INIVIYERIKEEIREGRRFENAFEAGFKKAFLSIMDANITTFIAVLFLTLLGTGVIQGFA
WSLSVGIVASLFSSLIFSRFILEFIISVRKSKFISISWSSKYAKSN
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgaaaaaaggatctaagcttatattgatattgttggtgacgttttttgcatgtctttta
atatttccgactttaaaatggtattttttaatgagcgttgaggataaaaaaataagctca
tattcacaagaggccttaagggattattcaaagaaaaaagccctgaatgatcttgttaag
cttaaggaactgtataataaagatcccaatagcagtattccagctagtttgtcttattta
attccaatagcaaaaaataattataggtcttcaatgaaaattccacctaatatttttact
gctaaaaccttgcgtgaaggatttttgactgattcggatatgggagaagtaagcttagag
atttatagatattatgagaacataaagaagggcaaaagcagaataatacatcttgggctt
gatttgtctggagggatgagtgttaccatttctcttgattattcaagtgttgaaaaaaaa
ttaggtcgttctttgacttttgctgagagagaggatgccatttatcgaataatgcaaatt
cttaaagatagggtarataggttcgggcttacagagcctaaaattgtaagagaagccggg
ggaaataaaattttcttagatattcctggagaaaaagatgagagtagagtaagcactctt
ttgagcggtaaaggcaatttgactttttatgtggttgatgatgagtctacatctcttttg
catagaaaaatattagaagcgggctctcttttttctattcctgaaattcaggcaagtatg
aaccttccagatagtaaacaaatttttccttggtatgttaaagattcttatggtgtggat
gatgagtcatcagttcgttattatgtagttgatgcaagccctgaaaattcatttgatggt
gctcacattaaagatgctggggtttctaacgatcctagaacaggccgagatactgttgct
tttagccttgatgttgatggaagtgaaaaattttttaaatttactcaaaaaaatgttgga
aagtctttggccgttgttatggaaggtaaaattaagtctgtggcaggaattggatatgct
atcactgggggcaatgtttcaattcaaggtgactcttttgataaaaaagaggctcaagat
cttgctttagtgtttaaaactgcagcttttccagttgatattaaaatagatgatttgaga
ataatagggcctactcttggtgctaggactattgatcttggcattaaagcttctgcgctt
gctctttgtttagtttttttgtttatatgtgtttattatggtttgagtggtgttgtagct
ggattttcacttgttatttataatgtatttttaattttagcgatattgtcggcctttaat
tttactttaactttaacaagcattgcaggtcttattttgacaatgggtatggccgttgac
ataaatatagttatttatgagagaattaaagaagaaattagagaaggcagaagatttgaa
aatgcttttgaagctggttttaaaaaggcatttttatcaattatggatgcaaatataaca
acatttattgcggtgctttttttaactcttcttgggacaggagttattcaaggttttgct
tggtctctttctgttggaattgtggcatccctttttagtagtttgattttttcaagattt
attttggaatttatcatatctgttagaaaaagcaaatttataagtatatcttggagttca
aaatatgcaaagagtaattaa

KEGG   Borreliella burgdorferi B31: BB_0653
Entry
BB_0653           CDS       T00012                                 

Symbol
secF
Name
(GenBank) protein-export membrane protein SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu03060  Protein export
bbu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BB_0653 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BB_0653 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbu02044]
    BB_0653 (secF)
Secretion system [BR:bbu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BB_0653 (secF)
SSDB
Motif
Pfam: SecD_SecF Endotoxin_C2 ABC2_membrane
Other DBs
NCBI-ProteinID: AAC66992
UniProt: O51597
Position
692629..693528
AA seq 299 aa
MQRVINFSKYGSNVLIVSAVLILVGLIYTFFYHGGYNWGIDFSSRVNINLSIEKSNIKEN
EIKKIFSPIYKTLDVNSIFSPDQNKSEFSIMVKSDVIDYAFKTEVQKTILDKLKETFDAN
IEVLDSYFIDSSFSSTLRIRSIFLVLGTFILILIYITLRFKLSYAIASILSIFHDIFFIV
AFLGVFRIEINSYIIVAILTIIGYSLNDTIIIFDRIRDNVKRLTDNTFLNVLNISISQTL
SRTVLTSVTTFVAVFSIYVFTEGSIKDFSLVFMVGVIVGTYSSVFIASPILLNLYKKIK
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcaaagagtaattaatttttcaaaatatggaagcaatgttttaattgttagtgccgtt
ttgattttggttgggcttatttatacttttttttatcatggtggatacaattggggaata
gatttttcttctagggttaatattaatctttcaatagaaaaatcaaatattaaagaaaat
gaaattaaaaaaatattctctccgatttataagactttagatgttaatagtattttttca
ccagatcagaataaaagtgaattctctattatggtaaagtctgatgtgattgattatgct
tttaaaacagaagttcaaaaaacaatattagataaacttaaagaaacatttgatgctaat
attgaagttttggattcttattttattgattcaagtttttcttctactttgagaattagg
tcaatttttttggtattaggaacatttatcctgattttgatttatataactttaagattt
aaactaagttatgctattgcttccatactttcaatatttcatgatatattttttatagtt
gcttttttaggggtatttagaatagagattaatagctatattattgtggcaatacttacc
attattggatattctttaaacgacacaataattatttttgataggattagagataatgtt
aagcgattaaccgataacacatttttaaatgtattaaacataagtattagtcaaacttta
tcaagaactgttttgacgtcagttacaacatttgttgcagtattttctatttatgtgttt
actgaaggatctataaaagatttttctttggtatttatggtaggggtaattgttggaact
tattcttctgtattcatagcgtctccaatacttttaaacctgtataaaaagataaagtag

DBGET integrated database retrieval system