KEGG   Borreliella burgdorferi B31: BB_0694
Entry
BB_0694           CDS       T00012                                 

Symbol
ffh
Name
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu02024  Quorum sensing
bbu03060  Protein export
bbu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BB_0694 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BB_0694 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB_0694 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbu02044]
    BB_0694 (ffh)
Enzymes [BR:bbu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     BB_0694 (ffh)
Secretion system [BR:bbu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BB_0694 (ffh)
  Eukaryotic Sec-SRP protein
   BB_0694 (ffh)
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA AAA_31 Zeta_toxin ArsA_ATPase ResIII AAA_17 AAA_30 AAA_33 Arf APS_kinase ATPase SRPRB ATP_bind_1 KTI12 CREPT AAA_7 Thymidylate_kin AAA_22 MeaB T2SSE AAA_18 ABC_tran NTPase_1 AAA_19 AAA_16
Other DBs
NCBI-ProteinID: AAC67049
UniProt: O51637
Position
735352..736686
AA seq 444 aa
MLESLGSNFRNFINYLSGKSTINDKNIAEAIEIIKNSLVDADVNLRVIRRFLNSIIEESK
GVKVLRGIDPKSQFIKIVNDNLVKFLGGKNYELSLHPANKQSYILMLGLQGSGKTTTCAK
LSLKLKKENRKVLLVAADTFRAAAVEQLKILGGQVGVPVFSIEGEKDPIKIVKASMKFAE
SNFFDSVIVDTRGRLEIESLLVEEIKKIKGILRPAETILVVDSMMGQVAVNIAKEFNENV
GLTGAIFSKFDSDTRGGAVLSFKSICAVPIKFIGVGEKIEDLDSFYPERIASRILGMGDV
VSLVEKVQSVVDKEEAIKLEEKINKASFNFEDYLSQFRRIRQVGGFSNFVSFLPGVSKSM
LNSNNLNEESFNKEEAIILSMTKKERINPVILNNPSRKKRIAMGSGTTVFDVNKLIKKFS
QATLIMKKMKNKDFQNKIASLLGK
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcttgaaagtttggggtcaaattttagaaattttataaactatctttctggaaaatct
acgataaatgataaaaacattgcagaggctattgagattattaaaaattctttagttgat
gctgatgttaacttaagagttataaggcgttttttaaattctataattgaagaatccaag
ggagtaaaagttttaaggggcattgatcctaaatctcagtttattaaaattgtcaatgat
aatcttgttaaatttttgggaggcaaaaattatgagcttagtttacatcctgccaataag
caatcttatattcttatgttgggacttcaaggttctggcaagaccacgacatgcgccaag
ctttctttaaagcttaaaaaggaaaatagaaaagtacttcttgtagctgctgatactttt
agagcggcggccgtagaacagttaaaaatattgggtggtcaagtaggtgttccagtattt
tcaattgaaggggaaaaagatcctattaaaattgttaaagcgtctatgaagtttgctgaa
tctaatttttttgattctgtaatagttgatactagaggacgacttgaaattgaatctttg
ttggttgaagagataaaaaaaataaaggggattttgcgacccgcagaaaccattttagta
gtagactctatgatggggcaagttgctgtaaatattgctaaggaatttaatgagaatgtt
ggacttaccggtgcaatattttctaagtttgattcagatactagggggggagctgtatta
tcttttaaaagtatttgtgcagttcccattaaatttattggtgttggagagaaaatcgaa
gatcttgattccttttacccagaaagaattgcttctagaattcttggcatgggggatgtt
gttagtcttgtagagaaggttcaaagtgttgttgacaaagaagaggctattaagcttgaa
gaaaaaattaataaagccagttttaattttgaagattatctgagtcaatttaggcgcatt
agacaagtaggagggttttctaattttgtaagttttttaccaggtgtttcaaaatcaatg
ctgaatagcaataatttaaatgaagaaagttttaataaagaagaagctattattctttct
atgactaaaaaagaaagaataaatccagtgattttgaataatccctcaagaaaaaaaaga
atagccatgggaagtggaacaactgtttttgatgttaataagctcataaaaaagtttagt
caagcaactttgattatgaaaaaaatgaaaaataaagattttcaaaataagattgcatcc
cttttgggaaaataa

DBGET integrated database retrieval system