KEGG   Borreliella burgdorferi B31: BB_R44
Entry
BB_R44            CDS       T00012                                 
Name
(GenBank) hypothetical protein
Organism
bbu  Borreliella burgdorferi B31
SSDB
Motif
Pfam: DUF603 HTH_23 HTH_Tnp_1_2 DUF2443 HalX DUF4473 GCR HTH_17
Other DBs
NCBI-ProteinID: AAF07515
UniProt: Q9S0D7
Position
cp32-4:28384..28950
AA seq 188 aa
MKRAKRSFNDYVAYFREGSLSDKEIAAKLRVSKVNVWRMRQKWESGETSVSEDSRLTISE
DTFEHLLSQTFRSEVNARKVRSELDLERANLELGFIHAFKRYSSVELFSMHTKIENLRAE
IDALNKASSKKNKQVVNGEINSLKSELDEYVKECSIREMELYYECMKKLSSAHEVENKGN
YKSYKGYK
NT seq 567 nt   +upstreamnt  +downstreamnt
ttgaaaagagccaaaaggtcttttaatgattatgttgcatactttagagaaggatcgtta
agtgataaagaaatagcagctaaactaagggtttctaaagtaaatgtgtggagaatgaga
caaaagtgggaaagtggagaaacttctgttagcgaggactctagactaacaattagtgaa
gatacttttgaacaccttttgtcgcaaacctttagatcagaagttaacgctaggaaagtt
agaagcgaattggatttagagcgagccaatttagaattagggtttatacatgcatttaag
cgatattctagtgttgagctttttagtatgcatactaaaatagaaaatttaagagccgaa
attgatgctttaaataaagcaagtagtaaaaaaaacaagcaagttgttaatggagaaatt
aattctttaaaaagtgagcttgatgaatatgtaaaggagtgctcaataagagaaatggag
ctttactatgaatgtatgaaaaaactttcttctgctcatgaagttgagaataaaggcaat
tacaaaagttataaagggtacaagtga

DBGET integrated database retrieval system