KEGG   Bacillus cereus ATCC 14579: BC3749
Entry
BC3749            CDS       T00127                                 

Definition
(RefSeq) UDP-2-acetamido-2,6-dideoxy-hexulose 4-reductase
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00541  O-Antigen nucleotide sugar biosynthesis
bce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BC3749
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BC3749
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_10 adh_short
Other DBs
NCBI-GeneID: 1206094
NCBI-ProteinID: NP_833474
UniProt: Q81A43 A0A5B7VLD5
Position
complement(3714822..3715733)
AA seq 303 aa
MKKNASLLITGANGFTGRHACHYFLEQGFHVIPMFQNRAHREKIRNGITCNLTNKSEVMK
VMKQIKPDYVLHLAGRNSVIESWTAALEYIEINVIGTLYLLEAIKQEASHCRTLVIGSAL
QADSMNEMKISNPYSLSKTMQVIIAEAWGGLMDSNIIIAKPSNLIGPGVSNGICSILAKK
IIDIESGRSKAIIEVNSLKDSRDFLDVRDAVKAYHVLLRDGINGKQYNIGSGVKRSLLDV
LEQYKELTQLNFFIEETEKSGSDSNESLATEEIKNLGWIPEIEFHQSLKDVLEYAKCSDI
CMQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatgcgagccttttaataactggtgcaaatggtttcacaggccgccatgct
tgccactattttttagagcagggctttcatgtaattcctatgtttcaaaatcgtgcacat
agagaaaaaattagaaatggtattacgtgtaatttaactaataagagcgaagtaatgaag
gtaatgaaacaaataaagccagactacgtattgcatttagcaggaaggaattcggttata
gaatcttggacagctgctcttgagtatatagagattaatgtaataggaacgttatattta
ttagaagcaattaagcaagaagcctcgcattgtagaacattagttataggatctgctttg
caagcagatagtatgaacgaaatgaaaatttcaaatccatatagtttaagtaaaacgatg
caagtcattattgcagaggcttggggaggattaatggattcaaatattatcattgcaaag
ccctcaaacttaattggtccaggggtatcaaatggtatttgttcgattctcgcaaagaaa
ataatagatatagaatcaggtagaagtaaggctattatcgaagtaaacagtttgaaagat
agtagagattttctagatgtacgtgatgcggtcaaagcgtatcatgtgttattacgagat
ggaataaatggaaaacaatataatatcggatcaggagtaaaacgatctttattagatgta
ctagaacaatataaagaattaacacagcttaatttttttatagaggaaacagagaaaagt
gggagcgactcaaatgagagtttagcaacagaggaaataaaaaatttaggttggatccca
gaaattgaatttcatcaatcattaaaagatgtacttgagtatgcgaagtgtagtgacatc
tgcatgcaatga

DBGET integrated database retrieval system