KEGG   Brachypodium distachyon: 100828788
Entry
100828788         CDS       T01717                                 

Definition
(RefSeq) cytochrome P450 93G2
  KO
K23135  flavanone 2-hydroxylase [EC:1.14.14.162]
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bdi00199]
    100828788
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.162  flavanone 2-hydroxylase
     100828788
Cytochrome P450 [BR:bdi00199]
 Cytochrome P450, plant type
  CYP93 family
   100828788
Motif
Pfam: p450 META
Other DBs
NCBI-GeneID: 100828788
NCBI-ProteinID: XP_003567058
UniProt: A0A0Q3GEG3
Position
2
AA seq 520 aa
MAGGMMEQVGGAVSDSVLVVSFLAAAVVLLLFTLVRHGRTQQGRLPPSPMALPLLGHLHY
LIRAPPHRAFDRIIARYGPLVYLRLGPSTHCVAIGSADVARDFLKFEGSIPERPLTAVTR
TLAYESAGFAFAPYGPHWRFMKRLCMSELLGPRTIEQLRPVRAAELAGVMRAAAAAAEQG
GTLDMSRELIRMSNNAIMRMVASSLPGDMADAARDCAKQVAELVGAFNVEDYVALCRGWD
LQGLGRRTRDVHARFDALLEVMIKTKEKERGAADEADKGGSKTKDLLDILMDAAADKTAE
VKLTRDNIKAFVLDIFTAGSDTTATTVEWMLAELLNHPACLAKLRAELDEVVGKSRLVGE
PDVAQMPYLQAVLKETLRLRPPAVFAQRETIEPVHVRGYTIPVKTSVFFNIFTIGRDPAW
WEEPLEFRPERFMPGGAGAAVDPKGQHLHLMPFGSGRRACPGMGLAMQAVPAFLAALVQC
FDWEVPSPPLDMEEEAGLVTSRKQPLVLLPTLRLSPSLLA
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcaggaggcatgatggagcaagtcggcggcgccgtctccgacagcgtgctggtcgtc
tccttcctcgctgcggccgtcgtcctcctcctgttcacgctggtcagacatggccgcacg
cagcagggccgcctgcccccaagccccatggcgctcccgctcctcggccacctccactac
ctcatccgcgccccgccccaccgcgcattcgaccgcatcatcgcccgctacgggcccctc
gtctaccttcgcctcgggccttccacccactgcgtcgccatcggctccgccgacgtcgcc
cgcgacttcctcaagttcgaaggcagcatcccggagcggcccctgactgccgtcacgcgc
accctggcctacgagtcggccggcttcgccttcgcgccctacggcccgcactggcgcttc
atgaagcggctctgcatgtcggagctgctcggaccgcgcaccatcgagcagctgcggccc
gtgcgcgccgcggagctcgcgggcgtcatgcgggccgcggcggcggcggcggagcagggc
gggacattggacatgagccgggagctcatccgcatgtccaacaacgccatcatgaggatg
gtggcgagctcgctgcctggcgacatggcggacgcggcgcgggactgcgccaagcaggtg
gcggagctggttggggccttcaacgtggaggactacgtggcgctgtgccgcggctgggac
ctgcaggggctgggccggaggacgcgtgacgtgcatgccaggttcgacgcgctgctggaa
gtcatgatcaagaccaaggagaaggagcggggcgctgccgatgaggcggacaagggcggc
agcaagaccaaggacttgcttgacatcctcatggatgcggcggcggacaagaccgccgaa
gtcaagctcaccagggacaacatcaaagctttcgtcctcgacatcttcactgctggttcg
gacacgacggccaccaccgtggagtggatgctagcggagctgctcaaccacccggcatgc
ctggcgaagctgagggcggagctggacgaggtagttggcaagtcccggctggtgggcgag
ccggacgtggcgcagatgccgtacctgcaggcggtgctcaaggagaccctgcggctgcgg
ccgccggcggtgttcgcgcagcgggagacgatcgagcccgtgcacgtccgcgggtacacc
atccctgtcaagacgtcggtcttcttcaacatcttcaccatcgggcgcgacccggcctgg
tgggaggagccgctcgagttccggccggagcggttcatgcctggcggggccggcgcggcc
gtggaccccaaaggccagcacctgcacctgatgccgttcgggagcgggcggcgcgcgtgt
cccggcatggggctcgccatgcaggccgtgccggccttcttggcggcgctggtgcagtgc
ttcgactgggaggtgccgagtccgccgctggacatggaggaagaagccgggctggtcacc
tcgcggaagcagccgctggtgctcctgcccacgctgcgccttagcccttctcttcttgcc
tga

DBGET integrated database retrieval system