KEGG   Brachypodium distachyon: 100841298
Entry
100841298         CDS       T01717                                 

Name
(RefSeq) cytochrome P450 93G1
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00941  Flavonoid biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100841298
   00943 Isoflavonoid biosynthesis
    100841298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bdi00199]
    100841298
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     100841298
Cytochrome P450 [BR:bdi00199]
 Cytochrome P450, plant type
  CYP93 family
   100841298
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100841298
NCBI-ProteinID: XP_003581003
UniProt: I1IW01
Position
5:2628622..2631056
AA seq 549 aa
MAMAASSMEQLLQVDPAMATYSILAIALVTAVLVLINRIGGNGAGKQRRHGLPPSPRRLP
VIGHLHLLRPPVHRTFQELASGLGAPLMHIRLGSTHCLVASSAAAATELIRSHEGKISER
PLTAVARQFAYGSDSGFAFAPYGPHWRAMKRLCMSELLGPRTVELLRPVRRAGLVSLLHT
VIRKSPEPVDLTAELIRMSNASIIRMMASTVPGSVTEEAQALVKAVAELVGAFNVEDYIA
VCRGWDLQGLGKRAADVHRRFDALLEDMIAHKEEARAAKKAIRGEDDQEPETKKTMAESK
DLIDILLDKMEDENAAEETKLTREKIKAFTIDVVTAGSDTSAAMVEWMLAELMNHPECLR
KVRDEIDAVVGSNRITGEADIANLPYLQAAYKETLRLRPAAPIAHRQSTEDMELATGGCF
TVPVGTAVFINLWAIGRDPEHWGQTALEFRPERFMLGGESEKLEPRGQHFQYLPFGSGRR
GCPGMGLALQSVPAVVAALVQCFHWTVVPKAGEEKAVIDMEESDGLVRARKHPLLLRASP
RLNPFPAVV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcaatggcggcgtccagcatggagcagctgctgcaggtcgacccagcaatggccact
tactccatcctcgccatcgcactcgtcacagcagttctagtcctgatcaacagaatcggc
ggcaacggcgccgggaagcagcggcggcatggtctgccgccgagtccccggaggctgccg
gtgatcgggcacctccacctgctccgtccccccgtgcaccgcaccttccaggagctggct
tccggcttgggcgccccgctgatgcacatccggctcggctccacgcactgcctggtggcc
agctccgccgccgccgccaccgagctcatccgctcccacgaggggaaaatctcggagcgg
ccactgacggccgtggcccggcagttcgcctacggctccgactccggcttcgccttcgcg
ccctacggcccgcactggcgcgccatgaagcgcctctgcatgtccgagctcctcggcccc
cgcaccgtcgagctcctccgccccgtccgccgcgccggcctagtctcactgctccacacc
gtgatccgcaagtcgccggagccggtggatctgacggcggagctgatccggatgtcgaac
gcgtccatcatccggatgatggcgagcacggtgcccgggagcgtcacggaggaggcgcag
gcgctggtgaaggccgtggcggagctcgtcggcgcattcaacgtagaggactacatcgcc
gtgtgccgcgggtgggacctgcaggggttagggaagcgggccgccgacgtgcaccggagg
ttcgacgcgctgctggaggacatgatcgcgcacaaggaggaagccagggcggccaagaag
gctattcggggagaagatgaccaggagccggagacgaagaagacgatggcggagagcaag
gacttgattgatatcttgctggacaagatggaggacgagaacgcggccgaggagaccaag
ctcaccagggagaagatcaaagccttcaccatcgacgtggtgacggccgggtcggacacg
tcggcggcgatggtggagtggatgctggcagagctgatgaaccacccggagtgcctccgc
aaggtgcgcgatgagatcgacgccgtcgtcggaagcaacaggatcaccggcgaggcagac
atagcgaaccttccctacctgcaggcggcgtacaaggagacgctgcggctccggcccgcg
gcgcccatcgcgcaccggcagtcgacggaggacatggagctcgccacgggcggctgcttc
acggtgccggtgggcacggcggtgttcatcaacctgtgggccatcgggcgtgacccggag
cactgggggcagacggcgctggagttcaggccggagcggttcatgctcggcggggagagc
gagaagctcgagccgcgcgggcagcatttccagtacctgccgttcgggagcgggcggcgc
gggtgccccggcatggggctcgcgctccagtccgtgccggccgttgtcgccgcgctcgtg
cagtgcttccactggaccgtcgtccccaaagccggcgaagagaaggcggtgatcgacatg
gaggagtcggacgggctggtgcgcgcgcgcaagcacccgctgctgctccgcgcctcgccg
cggctcaaccctttcccggccgtcgtctaa

DBGET integrated database retrieval system