KEGG   Priestia filamentosa: BEH_05750
Entry
BEH_05750         CDS       T03983                                 
Name
(GenBank) hypothetical protein
Organism
beo  Priestia filamentosa
SSDB
Motif
Pfam: YxiJ
Other DBs
NCBI-ProteinID: AKO94983
UniProt: A0A0H4L2M7
Position
complement(1158818..1159201)
AA seq 127 aa
MENIVIYERLKEINEELYDPFPYEETKSIKKDFKECLTSEACFNADLNTYMMNIVGSVNY
VLRGKGTKIPERQMNALSLTFFEAFPQYSFLENKMNQYPLFYREYARNEEARILILRYVE
NEGVLSQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atcgaaaacatagtgatttatgaaaggctgaaagaaataaatgaggaactatacgatcct
tttccttatgaagaaacaaagagtattaagaaagattttaaagagtgtttaacgtctgaa
gcttgttttaatgctgatcttaatacatacatgatgaacattgtaggaagcgttaattac
gttttgcgcggaaaaggaacgaaaattcctgagcgacagatgaatgctcttagtctcact
ttctttgaagcttttcctcaatattcttttttagaaaacaagatgaaccagtatccgctt
ttttatcgggagtatgctagaaatgaagaagcccgaatacttattttacgctatgtagag
aacgaaggggttttaagtcaataa

DBGET integrated database retrieval system