KEGG   Paraburkholderia fungorum: OI25_3056
Entry
OI25_3056         CDS       T03799                                 

Gene name
nahD
Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00626  Naphthalene degradation
bfn01100  Metabolic pathways
bfn01120  Microbial metabolism in diverse environments
bfn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    OI25_3056 (nahD)
Enzymes [BR:bfn01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     OI25_3056 (nahD)
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: AJZ60214
Position
1:3432396..3432986
AA seq 196 aa
MTIDFFFDFLSPYAYLARHRLAQVAALHGCAIAYKPIDLARAKLAIGNTGPANRDMPVKL
AYVVEDLKRWAARYRIPIEFIKNFNTKRMNVGTFYAEARGQQADYVRQAYHLAWGEGGAP
DDDAALRSIAVSMGWDAADFLRFLDSSEAETAYNESTLEAISAGVFGVPTMAVGRDMWWG
NDRIDFLETHLGRIAG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgacgatcgatttcttctttgattttctcagcccgtatgcctacctggcccgccatcgg
ttggcccaggtcgcggcgctgcacggttgtgcgatcgcgtataaaccgattgacctggcg
cgtgccaagctggccatcggcaacaccgggccagcaaatcgcgacatgccagtcaagctg
gcatatgtcgtggaggatcttaagcgctgggccgcgcgctatcggattccaatcgaattc
atcaagaacttcaacacaaagcgaatgaacgtcggcacgttctatgccgaagcaaggggg
cagcaggccgactacgtgcgacaggcataccacctggcgtggggtgaagggggcgcgccg
gacgacgatgcggcgttgcgctcgatcgccgtgtcaatggggtgggacgcagccgacttc
ttgcgatttctcgactcgtcggaagccgagacggcctacaacgaatcaactttagaggcg
atctctgccggcgtctttggcgttccgacgatggctgtcggtcgggacatgtggtggggt
aacgaccgcatcgattttcttgaaacccatctgggtcgaattgccgggtag

DBGET integrated database retrieval system