KEGG   Alkalihalobacillus gibsonii: BGM20_06740
Entry
BGM20_06740       CDS       T04820                                 

Definition
(GenBank) hypothetical protein
  KO
K06354  phosphatase RapE regulator
Organism
bgi  Alkalihalobacillus gibsonii
Pathway
bgi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BGM20_06740
Other DBs
NCBI-ProteinID: AOL30342
Position
1309495..1309629
AA seq 44 aa
MKSKLFISLSAVLIGLAFFGSMSNGEMKEASRNVTLAPTHEFLV
NT seq 135 nt   +upstreamnt  +downstreamnt
atgaaatctaaattgtttatcagtttatccgccgttttaattggacttgcctttttcgga
tctatgtctaatggcgaaatgaaggaagcatcccggaatgtaactctagcacctactcat
gaattccttgtttga

DBGET integrated database retrieval system