KEGG   Bacillus licheniformis ATCC 14580: BL05289
Entry
BL05289           CDS       T00197                                 
Symbol
yrzK
Name
(GenBank) YrzK
Organism
bli  Bacillus licheniformis ATCC 14580
SSDB
Motif
Pfam: YrzK
Other DBs
NCBI-ProteinID: AAU24389
UniProt: Q62S71
Position
complement(2773787..2773951)
AA seq 54 aa
MRYNQRMGRAIHEQDANLHLKEHADPERAGFMEETATELGLTSKESIQNKKNRK
NT seq 165 nt   +upstreamnt  +downstreamnt
atgaggtataatcaaagaatgggcagggcgatccatgagcaagatgcgaatctgcatcta
aaggagcatgcggacccggagcgcgccggcttcatggaagaaacggccactgagctgggg
ctgacgtccaaagaatcaattcagaataaaaagaaccgcaaatag

DBGET integrated database retrieval system