KEGG   Bacillus mobilis: MLA2C4_19595
Entry
MLA2C4_19595      CDS       T06928                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
bmob  Bacillus mobilis
Pathway
bmob00541  O-Antigen nucleotide sugar biosynthesis
bmob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmob00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    MLA2C4_19595
Enzymes [BR:bmob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     MLA2C4_19595
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_10 adh_short
Other DBs
NCBI-ProteinID: AYF07758
UniProt: A0A386V6F5
Position
complement(3791699..3792610)
AA seq 303 aa
MKKNASLLITGANGFTGRHACQYFLEQGFHVIPMFQNRAYRETIGNGITCNLTNKSEVMK
VMKRIKPDYVLHLAGRNSVIESWTAALEYVEINVIGTLYLLEAIKQEAPHCRTLVIGSAL
QADSMNEIKISNPYSLSKTMQVIIAEAWSELMNSNIIIAKPSNLIGPGVSNGICSILAKK
MITIESNKSEAIIEVNSLKDSRDFLDVRDAVKAYHVLLRDGTNGKQYNIGSGVKRSLLDV
IEQYKELTQLNFSIKEAEHSGSESNESLVIEDIKRLGWVPEIQFHQSLKDVLEYAKCSEI
CIQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatgcgagccttttaataactggtgcaaatggtttcacaggacgccatgct
tgccaatattttttagagcagggctttcatgtaattcctatgtttcaaaatcgtgcatat
agagaaacaattgggaatggtattacttgtaatttaactaataagagcgaagtaatgaag
gtaatgaaacgaataaagccagattatgtattgcatttagcaggaaggaattcggtcata
gagtcttggacagctgctcttgaatatgtagagattaatgtaatagggacattatattta
ttagaagcaattaagcaagaagcacctcactgtagaacgttggttataggatctgctttg
caagcagatagtatgaacgaaataaaaatttcaaatccatatagtttaagtaaaacgatg
caagtcattattgcagaagcgtggagtgaattaatgaattcaaatattatcattgcaaag
ccctcgaatttaattggtccaggagtatcgaatggtatttgttctattcttgcaaaaaaa
atgataacgatagagtcgaataaaagtgaagcaattattgaagtaaacagtttgaaagat
agtagggattttttagatgtacgtgatgcggttaaagcgtatcatgtgttattacgcgat
ggaacaaatggaaaacaatataatattggatcaggggtaaaacggtctttattagatgta
atagaacaatacaaagaattaacacagctaaatttttccataaaagaagcagagcatagt
gggagcgaatcaaatgagagtttagtaatagaggatataaaaaggttaggttgggtccca
gaaattcaatttcatcaatcattaaaagatgtacttgagtatgcgaagtgtagtgaaatc
tgcattcaatga

DBGET integrated database retrieval system