KEGG   Bacillus mycoides ATCC 6462: BG05_2275
Entry
BG05_2275         CDS       T03798                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00541  O-Antigen nucleotide sugar biosynthesis
bmyo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BG05_2275
Enzymes [BR:bmyo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BG05_2275
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_10 adh_short Synapsin
Other DBs
NCBI-ProteinID: AJH18912
UniProt: A0A0B5S8J4
Position
2172229..2173137
AA seq 302 aa
MKRNASLLITGANGFTGRHACQYFLEQGFHVIPMFQNRSHREKIENGITCDLTNKSEVMK
VIKQIKPDYVLHLAGRNSVNESWTASLEYIEINVIGTLYLLEAIKQEASHCKTLVIGSAL
QADSMKNIKVSNPYSLSKTMQVIIAEAWGGLMDSNIIIAKPSNLIGPGVSNGVCSILAKK
MIDIESGRSKAIIEVNSLKDSRDFLDVRDAVKAYHVLLRDGINGKQYNIGSGVKRSLLDV
LEQYKGLTQLNFTIKETENSESGSNESLVLEDIKKLGWVPEIPFQQSLKDVLEYAKCSDI
CI
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaaagaaatgcgagccttttaataactggtgcaaatggcttcacaggacgtcatgct
tgccaatattttttagagcagggctttcatgtaattcctatgtttcaaaatcgttcacat
agagaaaaaatcgaaaatggtattacttgtgatttaacaaataagagtgaagtaatgaag
gtaattaaacaaataaaaccagactatgtattgcatttagcaggaagaaactcagttaat
gagtcttggacagcttctctggaatatatagagattaacgtaatagggactttatattta
ttagaagccattaagcaggaagcctcgcattgtaaaacattagttataggatctgcattg
caagcagatagtatgaaaaacataaaagtttcaaatccatatagtttaagtaaaactatg
caagtcattattgcggaggcttggggcggattaatggattcaaatattatcattgcaaag
ccctcaaatttaattggtccaggagtatcgaatggtgtttgttcaattctcgcaaaaaaa
atgatagatatagaatcaggtagaagtaaagcgattattgaagtaaacagtttgaaagat
agtagagactttctagatgtacgtgatgcagttaaagcgtatcatgtgttattacgtgat
ggtataaatggaaaacaatataatattggatcaggagtaaaacgctctttattagatgta
ttggaacaatataaaggattaacacagttgaattttactataaaagaaacagagaatagt
gagagcggctcaaatgaaagtttagtattagaggatataaaaaagttaggttgggttcca
gaaatcccatttcagcaatcattaaaagatgtacttgagtatgcgaagtgtagtgacatc
tgcatttaa

DBGET integrated database retrieval system