KEGG   Brassica napus (rape): 106379685
Entry
106379685         CDS       T04128                                 

Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic isoform X1
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106379685
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106379685
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106379685
    1.1.1.-  
     106379685
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106379685
NCBI-ProteinID: XP_013675035
UniProt: A0A078JQ35
AA seq 406 aa
MAAALQTNTRLNPINLVPGRSLANPSRAPCRVRCAAASPGKKRFNIALLPGDGIGPEVIS
VAKNVLQQAGSLEGLEFNFQEMPVGGAALDLVGVPLPEESFTAAKQSDAILLGAIGGYKW
DNNEKHLRPEMALFYLRRDLKVFANLRPATVLPQLVDASTLKREVAEGVDMMIVRELTGG
IYFGEPRGIKTNENGEEVGFNTEFYAAHEIDRIARVAFETARKRRGKLCSVDKANVLDAS
ILWRRRVTALASEYPDVELTHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLGVSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDAVLDTLNKGFRTGDIYSPGNKLVGCKEMGEEVLKSVDSKVTATV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcagctttacaaacgaacacacggttgaatccgatcaatctcgttccaggcaga
tctctcgccaatccttctcgcgcgccgtgtagagtaaggtgcgccgcagcttcaccgggg
aaaaaacggtttaacatcgctctccttcccggcgacgggattggtccggaagtcatatcc
gtcgccaagaacgtgctccaacaagctggatcactcgaaggactggagtttaatttccag
gagatgcctgtcggaggagcagctttggatttggtcggagtgcccttgcctgaggaatcc
tttacagctgctaaacaatctgatgccatacttcttggagctatcggagggtacaaatgg
gacaacaatgagaaacatctgagacctgagatggctctgttttaccttcgaagagatctc
aaagtctttgcaaacctcagacccgctacagttttgccacagctagttgatgcttccacc
ttgaagagagaagtggcagaaggggttgatatgatgattgtaagggagcttactggaggt
atttactttggagagccaaggggaatcaagaccaacgaaaatggcgaagaagtaggcttt
aatacagagttctacgctgctcatgagatcgataggattgctcgtgttgctttcgagact
gctaggaaacggcgtggcaagctgtgttctgtcgacaaagccaatgtgttggacgcatca
atattatggaggagaagagtaacagcgttagcctctgagtatccagacgttgaactaaca
catatgtatgtcgataatgctgcaatgcagcttattcgtgaccccaaacagtttgacaca
attgtcaccaataacatttttggtgatatattatctgatgaagcttcaatgatcactgga
agcattgggatgcttccatctgctagtctcggtgtatcgggacctggactgtttgagcct
atacatggttcagcaccagatatagctggtcaggacaaggcaaacccattggccaccatt
ctcagcgctgcaatgctcctgaaatatggacttggagaagaaaaggctgcaaagaggatc
gaagacgcggtcttggatactttgaacaaagggtttagaaccggtgacatctactcccct
ggaaataaactggtgggatgcaaggagatgggtgaggaagtgctaaaatcagtggactcc
aaagttacagctactgtttaa

DBGET integrated database retrieval system