KEGG   Brassica napus (rape): 106402047
Entry
106402047         CDS       T04128                                 

Name
(RefSeq) tricyclene synthase, chloroplastic isoform X1
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00902  Monoterpenoid biosynthesis
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    106402047
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     106402047
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 106402047
NCBI-ProteinID: XP_013698142
UniProt: A0A078G8Y9
AA seq 595 aa
MASLVQMGSPLIYSKALAKTTQRPQPFTCTIVAKTTPGSESPSDPRRSANYRPSLWDHHH
LLSVKNKYTNIKSVRERDLLKETVRKMLDHERSTHVDQLELIDDLQKLGVSYHFEQEIDN
MLTFTYHKLDKSNFMEYDMEYDLHANALKFRLLRQHGFNVSEDVFDVFHENCGKFESGEI
NGFISLYEASYLSTKSDTKLQNYIRFFATQQLRDFVDTHSNKNCASFGVGEMVAQALDMP
YHWRMRRLATRSYINLYGMKPNKNPVLVELAKLDFNIVQAVYQEELKYVSSWWRETGLAN
QLHFSRDRIVENYFWTIGQIQEPQFGYVRRIMAKLYTLLTTIDDIYDIYGTLEELQLLTA
AFASWDVNRLDELPEYMRLCFLVVYNEVNSIGCDILRNKNINVIPFLRKSWADVSNAFLI
EAIWYKRGHKPNTEEYMQNAWKSIGVPTICVHFYCVFSDQLSVQVLETLSEHLQDVVRCS
AFVVRLANDLVTSQEELERGDVLKSIQCYMNETGASQEKACVHVQQIINDMWDEMNYEKT
KCRSLLIPQDFVESVMNLARMSQCMYQYGDGHGSPEKAKIVDSVMSLLFNPIILD
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggccagtctagtgcagatgggttcacctcttatttacagtaaagcccttgcgaagact
acccaacgtcctcagccattcacatgcaccatagtagctaaaacgacaccgggtagtgag
tctccatctgatcctcgtcgttccgcaaactatcggccttctctttgggaccatcaccat
ctcctctcggtcaagaataaatatacgaatattaaaagtgtgcgagagagagatttattg
aaagaaactgtgagaaagatgctcgatcatgagaggagtactcatgtcgaccaattggag
cttattgacgatctacaaaaactaggggtttcataccattttgaacaggaaatcgacaat
atgttgacatttacttatcacaaattagataaaagtaacttcatggagtacgacatggaa
tacgatctacatgctaatgcactcaaattccgactgcttagacaacatggtttcaatgtt
tcagaagatgtatttgatgttttccatgaaaactgtgggaagtttgagagcggtgaaata
aatggtttcatatctctgtacgaggcatcatatctttcaacaaagtcggatactaagctg
caaaactacatcagattttttgcaacacaacaactcagagactttgttgatactcatagt
aataaaaattgtgcatcctttggcgttggagagatggtggctcaagcgttagatatgccc
taccattggcgaatgagaaggctagccacgagatcgtacataaatttgtatggaatgaaa
ccaaacaagaaccctgtcttagttgaattggccaagctcgatttcaatatcgtacaagct
gtttatcaagaagagctcaaatacgtttccagctggtggagggagacaggtttagctaat
caacttcatttttcaagagatagaatagtggaaaattatttttggactattggacaaatc
caagagcctcaatttggttacgttagacgaataatggccaagttatatacacttctcaca
actatcgacgacatctacgatatttatggtactcttgaagaacttcaactcctcactgcc
gcctttgcaagttgggatgtaaatcgtctcgatgaactccccgagtatatgaggttgtgt
tttcttgtagtgtacaatgaagtcaacagcattggatgtgatatcctcagaaataaaaac
atcaacgtgattcctttccttagaaagtcttgggcagatgtaagcaatgcatttttaata
gaagcaatatggtacaaaagagggcacaaaccaaatacggaagagtacatgcaaaatgct
tggaaatcaatcggggtcccaacaatatgtgttcacttctactgtgtattctctgaccaa
ctctctgttcaagtcttggagactttgtccgagcacttacaggacgttgtccgatgctct
gcctttgtggtccgtctagccaacgaccttgtaacttctcaggaggaattggagagagga
gatgtcctcaaatcaatccagtgttacatgaacgagaccggagcttcccaagagaaagca
tgtgtgcacgtgcagcagataatcaacgacatgtgggacgaaatgaattacgagaaaacg
aaatgtcggtctttgctaatccctcaagattttgtggaatcagtcatgaacttggcacgc
atgtcgcaatgcatgtatcaatatggagatggacatggctctcccgagaaagccaaaatc
gttgatagtgtcatgtccttactctttaaccccattatcctagattga

DBGET integrated database retrieval system