KEGG   Brassica napus (rape): 106419086
Entry
106419086         CDS       T04128                                 

Name
(RefSeq) UDP-glycosyltransferase 76C2
  KO
K13493  cytokinin-N-glucosyltransferase [EC:2.4.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00908  Zeatin biosynthesis
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    106419086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bna01003]
    106419086
Enzymes [BR:bna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     106419086
Glycosyltransferases [BR:bna01003]
 Others
  Hydrophobic molecule
   106419086
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 106419086
NCBI-ProteinID: XP_013715300
Position
A10:18999401..19002768
AA seq 452 aa
MEKKKNGVRVILFPLPLQGCINPMLQLANILHSQGFSITVIHTRFNGPKASNHPLFTFLE
IPDGLSESQINDEPTSNVMSLLAQINVNAESPFRECLQKLLLEESEKVSCLVDDCGWLFT
QSVAESLNLPRLVLSTFKATFLNAYPILPRIRTKGYLPVSDSEAEDSVLEFPPLLKRDLP
RIFGEDGEKLDPFLDTIVDTTMRSSGLIFMSCQELEKDSLTLSNEIFKVPVFAIGPFHSY
FSASSSSLFRQDETCIHWLDNQEDKSVIYVSLGSVVNITESEFLEIAWGLSNSKQPFLWV
VRPGLVLGAEWIELLTEELVRSLEKKGKIVKWSPQQEVLAHRAVGGFLTHNGWNSTLESI
CEGVPMICLPGGWDQMLNARFVSDVWRVGIHLEGKIERKEIEKAVRMLMVESEGEKIRGR
MNVLKDEVGRSVKDGGSSFRSIAALTNHILSL
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggagaagaagaagaatggtgtgcgagtgattctcttcccgttgccattacaaggctgc
ataaaccctatgcttcagctcgccaacatccttcactcacaaggcttctcaatcactgtc
atccacacgcggttcaacggtccaaaagcttcgaaccatcctctcttcaccttcttagag
attccagacggcttgtctgaatcccagatcaacgacgagcctacctctaatgttatgtct
ctcctcgcgcaaatcaacgtcaacgctgagtccccgtttcgtgaatgcttgcaaaaactg
ttgcttgaagaatcagagaaggttagctgtttggtcgatgattgtggatggctcttcaca
caatctgtcgcagagagtttgaatctcccgaggcttgttctctctactttcaaagccact
ttcttgaatgcttatcctattctcccgcgtatccgaaccaaaggctatcttccagtttca
gattcggaagcagaggactctgttcttgagttccctccgcttctaaagagagatctgcca
aggattttcggagaagacggagagaaactcgatccattcttagacactatcgtcgacacg
acgatgagatcatcaggtctaatattcatgtcctgccaagagctggagaaagattcgttg
actctctccaacgaaatcttcaaggttccagtctttgcgattggtccgtttcacagctac
ttctccgcttcgtctagtagccttttcagacaagacgagacttgcattcattggttagat
aatcaagaagataagtccgttatctacgtgagtctaggaagcgttgtgaacataacggaa
tcagagtttttggagattgcttggggtttaagcaatagcaaacagcctttcttgtgggtg
gtacgacccggtttggtcttaggcgcagagtggatcgagttactcaccgaagagctcgtg
aggagccttgagaaaaaagggaagatagtgaagtggtctccacaacaggaggttcttgcg
caccgagccgttggtgggttcttgacacacaatggttggaactcgacgctggagagtata
tgcgaaggggttcctatgatctgtttgcctggaggttgggatcaaatgctgaacgcaaga
tttgtgagcgatgtttggagggttggtattcatttggagggtaagatcgagaggaaggag
atcgagaaagctgtgaggatgttaatggttgaaagtgaaggagaaaagattcgtgggagg
atgaatgttttgaaagatgaggttgggagatcggttaaagatggtggctcgtcttttagg
tctatagcagccctaacgaatcatatactatcgttgtaa

DBGET integrated database retrieval system