KEGG   Brassica oleracea (wild cabbage): 106328108
Entry
106328108         CDS       T04124                                 

Name
(RefSeq) tricyclene synthase, chloroplastic-like
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00902  Monoterpenoid biosynthesis
boe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    106328108
Enzymes [BR:boe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     106328108
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 106328108
NCBI-ProteinID: XP_013621933
UniProt: A0A0D3B7J8
Position
C3
AA seq 591 aa
MASLVQMGSPLIYSKALAKTTQRPQPFTCTIVAKTTPGSESPSDPRRSANYRPSLWDHHH
LLSVKNTYTNIKSVRERDLLKETVRKMLDHERSTHVDQLKLIDDLQKLGVSYHFEQEIDN
MLTFTYHKLDKSNFMEYDLHANALKFRLLRQHGFNVSEDVFDVFHEDCGKFESGEINGFI
SLYEASYLSTKSDTKLQNYIRFFATQQLRDFVDTHSNKNCESFGVGEMVAQALDMPYHWR
MRRLATRSYINLYGMKPNKNPVLVELAKLDFNIVQAVYQEELKYVSSWWRETGLANQLHF
SRDRIVENYFWTIGQIQEPQFGYVRRIMAKLYTLLTTIDDIYDIYGTLEELQLFTAAFAS
WDVNRLDELPEYMRLCFLVVYNEVNSIGCDILRNKNINVIPFLRKSWADVSNAFLVEAIW
YKRGHKPNTEEYMQNAWKSIGVPTICVHFYCVFSDQLSVQVLETLSEHLQDVVRCSAFVV
RLANDLVTSQEELERGDVLKSIQCYMNETGASQEKACVHVRQIINDMWDEMNYEKTKCRS
LLIPQDFVESVMNLARMSQCMYQYGDGHGSPEKAKIVDSVMSLLFNPIILD
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccagtctagtgcagatgggttcacctcttatttacagtaaagcccttgcgaagact
acccaacgtcctcagccattcacatgcaccatagtagctaaaacgacaccgggtagtgag
tctccatctgatcctcgtcgttccgcaaactatcggccttctctttgggaccatcaccat
ctcctctcggtcaagaatacatatacgaatattaaaagtgtgcgagagagagatttgttg
aaagaaactgtgagaaagatgctcgatcatgagaggagtactcatgtcgaccaattgaag
cttattgacgatctacaaaaactaggggtttcataccattttgaacaggaaatcgacaat
atgttgacatttacttatcacaaattagataaaagtaacttcatggaatacgatctacat
gctaatgcactcaaattccgactgcttagacaacatggtttcaatgtttcagaagatgta
tttgatgttttccatgaagactgtggtaagtttgagagcggtgaaataaatggtttcata
tctctgtacgaggcatcatatctttcaacaaaatcggatactaagctgcaaaactacatc
agattttttgcaacacaacaactcagagactttgttgatactcatagtaataaaaattgt
gaatcctttggcgttggagagatggtggctcaagcgttagatatgccctaccattggcga
atgagaaggctagccacgagatcgtacataaatttgtatggaatgaaaccaaacaagaac
cctgtcttagttgaattggccaagctcgatttcaatatcgtacaagctgtttatcaagaa
gagctcaaatacgtttccagctggtggagggagacaggtttagctaatcaacttcatttt
tcaagagatagaatagtggaaaattatttttggactattggacaaatccaagagcctcaa
tttggttacgttagacgaataatggccaagttatatacacttctcacaactatcgacgac
atctacgatatttatggtactcttgaagaacttcaactcttcactgccgcctttgcaagt
tgggatgtaaatcgtctcgatgaactccccgagtatatgaggttgtgttttcttgtagtg
tacaatgaagtcaatagcattggatgtgatatcctcagaaataaaaacatcaacgtgatt
cctttccttagaaagtcttgggcagatgtaagcaatgcatttttagtagaagcaatatgg
tacaaaagagggcacaaaccaaatacggaagagtacatgcaaaatgcttggaaatcaatc
ggggtcccaacaatatgtgttcacttctactgtgtattctctgaccaactctctgttcaa
gtcttggagactttgtccgagcacttacaggacgttgtccgatgctctgcctttgtggtc
cgtctagccaacgaccttgtaacttctcaggaggaattggagagaggagatgtcctcaaa
tcgatccagtgttacatgaacgagacaggagcttcccaagagaaagcatgtgtgcacgtg
cggcagataatcaacgacatgtgggacgaaatgaattacgagaaaacgaaatgtcggtct
ttgctaatccctcaagattttgtggaatcagtcatgaacttggcacgcatgtcgcaatgc
atgtatcaatatggagatggacatggctctcccgagaaagccaaaatcgttgatagtgtc
atgtccttactctttaaccccattatcctagattga

DBGET integrated database retrieval system