Bradyrhizobium ontarionense: LQG66_05485 Help Entry LQG66_05485       CDS       T10106                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism boy  Bradyrhizobium ontarionense Pathway boy02024   Quorum sensing boy03018   RNA degradation Brite KEGG Orthology (KO) [BR:boy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     LQG66_05485 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     LQG66_05485 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:boy03019]     LQG66_05485 (hfq)    03036 Chromosome and associated proteins [BR:boy03036]     LQG66_05485 (hfq) Messenger RNA biogenesis [BR:boy03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      LQG66_05485 (hfq) Chromosome and associated proteins [BR:boy03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     LQG66_05485 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  UFZ05766 Position complement(1226530..1226778) Genome browser AA seq 82 aa AA seqDB search MAADRAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRRDGHSQLVYKH AISTIMPGAPIQLFEGGEDASA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcggcagaccgcgcacaaaacctacaagacacttttctcaaccatgtccgcaaaacc aagacgccgctcacgatctttctggtcaatggcgtgaaattgcaggggattgtcacatgg ttcgacaatttctgcctgctgctccggcgcgacggtcactcgcagctcgtctacaagcat gcgatctccaccatcatgccgggcgccccgatccagctgttcgagggtggcgaggacgcc tctgcgtga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (2) Pfam (2) All databases (3) Download RDF

DBGET integrated database retrieval system