KEGG   Bordetella petrii: Bpet3738
Entry
Bpet3738          CDS       T00637                                 

Name
(GenBank) large terminal subunit of phenylpropionate dioxygenase
  KO
K03268  benzene/toluene/chlorobenzene dioxygenase subunit alpha [EC:1.14.12.3 1.14.12.11 1.14.12.26]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00623  Toluene degradation
bpt00625  Chloroalkane and chloroalkene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3738
   00625 Chloroalkane and chloroalkene degradation
    Bpet3738
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3738
   00623 Toluene degradation
    Bpet3738
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.3  benzene 1,2-dioxygenase
     Bpet3738
    1.14.12.11  toluene dioxygenase
     Bpet3738
    1.14.12.26  chlorobenzene dioxygenase
     Bpet3738
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: CAP44081
UniProt: A9I2P0
Position
3947376..3948905
AA seq 509 aa
MSLEDVAIGCRSSKTKASSVWSTTSSTRRTDLKTEALIDFETAQSPTTHPSTTMKREETM
NHTDTSPIKLRKNWNAREMQALFDERAGRIDPRIYTDEDLYQIELERVFGRSWLLLGHET
QIKKPGDYTTNYMGEDPVLVVRQKDGSIAVFLNQCRHRGMRICRSDAGNAKAFTCSYHGW
AYDTAGNLVNVPFEAESFPCLDKKEWSPLKARVATYKGLIFANWDHDAPDLDTYLGEAKF
YMDHMLDRTEAGTEAIPGVQKWVIPCNWKFAAEQFCSDAYHACTTSHLSGILAGLPDGVE
LADHAPPTVGKQYRAPWGGHGTGFFIGAPNLLLAMMGPKITSYWTEGPASEKAAQRLGSV
ERGSKLMVEHMTVFPTCSFLLGPNTVRTWHPRGPNEVEVWAFTVVDADAPDDIKEEFRRQ
TLRTFSAGGVFEQDDGENWVEIQHILRGHKARSRPFNAEMSMGQTIDDDPVYPGRISNNV
FSDEAARGMYAQWLRMMTSSDWAALNATR
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtctttggaagatgtggccattgggtgcagatcgagcaaaaccaaggcttcatccgtt
tggtcaacgacttcctcgacacggaggactgatctcaagaccgaagcgctcattgatttc
gaaaccgcgcaatcacccaccacccacccatccaccaccatgaaacgtgaggagacaatg
aatcacaccgacacctcccctatcaagctgcgcaagaactggaacgcccgcgagatgcag
gcgctctttgacgagcgcgccggacgtatcgacccgcgtatctataccgatgaagacctg
taccagatcgaactggagcgcgtcttcggcaggtcgtggcttctgttggggcatgaaacc
cagatcaagaaaccgggcgactacaccacgaactatatgggcgaagaccccgtcttggtc
gtgaggcagaaggacggcagcatcgctgtattcctgaaccaatgccgccaccgcggcatg
cgcatctgccgctcggatgccggcaacgcgaaggctttcacgtgcagctaccacggctgg
gcctacgacacggcgggcaacctggtcaacgtccccttcgaggctgaatccttcccttgc
ctggacaagaaggaatggagccccttgaaggcccgggtcgcgacctacaagggcctgatc
ttcgccaactgggaccacgacgccccggatctggacacctatctgggcgaggcgaagttc
tacatggaccacatgctcgaccgtaccgaggccggcaccgaagccatcccgggtgtgcag
aagtgggtcatcccctgcaactggaaattcgccgccgaacagttctgcagcgacgcgtac
cacgcctgcacgacctcgcatctgtccggcatcctggccggtctgccggacggcgttgag
ctggccgatcacgctccgccgacggtcggcaagcaataccgtgcgccgtggggcggacac
ggaaccggtttctttattggagcacccaatctcctgctcgccatgatggggccgaagatc
accagctactggaccgaaggccccgcctctgaaaaggcggcccagcgcctgggcagcgtc
gaacgcggctccaaactcatggtcgagcacatgactgtgtttcccacgtgctccttcctt
ctaggccccaacacggttcggacatggcatccacgcgggccgaacgaggtggaggtgtgg
gcgttcacggtggtcgacgccgatgctcccgacgacatcaaggaagagttccgccgccag
acgctgcgcaccttctccgctggcggggtgttcgagcaggacgacggggagaactgggtc
gagatccagcacatcctgcgcggccacaaggcacgcagccgaccgttcaacgcggagatg
agcatgggccagaccattgacgacgatccggtctaccccgggcgcatcagcaacaacgtc
ttcagcgatgaagcggcccgcgggatgtatgcccagtggctgcggatgatgacctcgtct
gactgggccgcgctgaacgccacacgctga

DBGET integrated database retrieval system