KEGG   Bordetella petrii: Bpet3741
Entry
Bpet3741          CDS       T00637                                 

Name
(GenBank) putative ferredoxin reductase
  KO
K18090  benzene/toluene/chlorobenzene dioxygenase ferredoxin reductase component [EC:1.18.1.3 1.18.1.-]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00623  Toluene degradation
bpt00625  Chloroalkane and chloroalkene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3741
   00625 Chloroalkane and chloroalkene degradation
    Bpet3741
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3741
   00623 Toluene degradation
    Bpet3741
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Bpet3741
    1.18.1.-  
     Bpet3741
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Reductase_C DAO AlaDh_PNT_C NAD_binding_8 GIDA Pyr_redox_3 Lycopene_cycl FAD_binding_3
Other DBs
NCBI-ProteinID: CAP44084
UniProt: A9I2Q1
Position
3949910..3951142
AA seq 410 aa
MATHVAIIGNGVAGFTTAQALRAEGFEGRISLIGNEPHLPYDRPSLSKAVLGGSLEHPPV
LAEADWYGEARIDMLSGRSVTNLNVDARTISLDDGSTFAADAIVIATGSRARTLALPGSQ
LTGVVTLRTYDDVRPLCRGWTPATRLVIAGGGLIGCEVATTARKLGLAVTILESADELLV
RVLGRRIGAWLRGLLTELGVRVELGTGVAGFSGDDRLEEVLASDGRRFAADNALVCIGAE
PEDQLARQAGLSCDRGVIVDDHGATHAEGVFAVGDAASWPLRDGGRRSLETYMNAQRQAA
AVAAAILGKHGSAPQVPVSWTEIAGHRMQMAGDIEGPGEFVLRGTLGDGAALLFRLRDGR
IQAVVAVDAPRDFAMAARLVEARAAIEPARLADFSNSMRDLVRAQQGDSA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcgacgcatgtggcgatcatcggcaatggtgtggcgggctttacgaccgcgcaagcc
ctgcgtgctgaaggctttgaggggcggatctcgctgatcgggaacgaaccgcatctgccc
tatgaccgaccgtctctgtccaaggccgtgctcggcggcagtcttgagcatccgcccgta
ttggcggaagccgactggtacggcgaggcgcgcatcgacatgctgtccggccgaagtgtc
accaacctgaacgtggacgctcgaacgatcagcctagacgatggaagcacgttcgctgca
gacgccatagtcatcgccacgggcagccgggcacgaacgcttgcgttgcctggcagccaa
ctgaccggcgttgtcacgcttcgcacctacgacgacgtgcggccgctgtgccgtggctgg
acgcctgcaacgcgactggtgatcgcaggcggcggattgatcggctgcgaagtcgcgacg
acggcgcgcaagctcggcctggcggtgacgattctggaatccgccgacgaactgctggtg
cgtgtgctgggccggcgcatcggcgcctggctgcgcggcctgttgacggaactcggcgta
cgggtcgagctgggaacaggcgtggccggcttctctggcgacgaccggctcgaagaggta
ctggccagcgatggacgccgcttcgccgccgacaacgcgcttgtctgcatcggcgccgag
cccgaggatcaactcgcgcgtcaggcgggcctgtcctgcgaccggggcgtcattgtcgat
gaccacggcgcgacgcatgccgaaggggtattcgcagtcggcgatgcggccagttggccg
ctgcgcgatggcggcaggcgttcgctcgaaacctacatgaacgcgcagcgccaggccgcc
gcggtggcagcggccattctgggaaagcatggatcggcgccgcaggtgcccgtgtcctgg
acggagatcgccgggcatcggatgcagatggcgggcgatatcgaagggccgggcgaattc
gtcttgcgcggcacgctgggggatggcgcggcgctgctgttccggctgcgggacggaagg
attcaggccgtcgtcgcggtcgacgcgccgcgtgacttcgcgatggcggcccgattggtg
gaagcgcgtgcagccatcgagccggcgcggctggcagatttttcaaacagcatgcgcgat
ctcgtgcgtgcacaacaaggagactcagcatga

DBGET integrated database retrieval system