Brevibacillus sp. HD3.3A: HP435_21100 Help Entry HP435_21100       CDS       T10166                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism breh  Brevibacillus sp. HD3.3A Pathway breh00670   One carbon pool by folate breh00790   Folate biosynthesis breh01100   Metabolic pathways breh01240   Biosynthesis of cofactors breh04981   Folate transport and metabolism Module breh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:breh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HP435_21100    00670 One carbon pool by folate     HP435_21100  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     HP435_21100 Enzymes [BR:breh01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      HP435_21100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  UED67752 Position complement(4516323..4516799) Genome browser AA seq 158 aa AA seqDB search MISLIVAYAKNQVIGKDGDMPWSLPADLKNVKEITTGNTIVMGRKTFESIGRPLPNRRNV VLTRSRDFHPEGVDVVHTKEEVLALGDVIIFGGANIYGQFLDVVDRMYITEIELETEGDT FFPAWDKDAFVLVDKREGVVDEKNAYPHTFYVYERKNG NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgatcagtctgattgtggcctacgcgaaaaatcaggtgatcggcaaagatggcgacatg ccgtggagcctgcccgccgatttgaaaaacgtcaaggaaatcacgacagggaacacgatt gtgatgggccgcaagacgttcgaatcgatcggcagaccgctgccgaacagacgaaatgtc gtgctgacgagaagccgcgactttcatccggaaggtgtcgatgtcgtccatacgaaggaa gaagtgctcgctctgggcgacgtcatcatttttggcggcgccaacatttacgggcagttc ctggacgtggtagatcgcatgtacattaccgaaatcgagctggaaacagagggcgacacg tttttccctgcgtgggacaaagacgcgtttgtgcttgtggacaagcgcgaaggtgttgtc gatgaaaagaatgcctacccgcatacgttttacgtgtatgaacgcaaaaatggttag

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (1) Pfam (1) All databases (2) Download RDF

DBGET integrated database retrieval system