KEGG   Brassica rapa (field mustard): 103850918
Entry
103850918         CDS       T03449                                 

Name
(RefSeq) 3-isopropylmalate dehydrogenase 1, chloroplastic
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00290  Valine, leucine and isoleucine biosynthesis
brp00966  Glucosinolate biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    103850918
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    103850918
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     103850918
    1.1.1.-  
     103850918
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 103850918
NCBI-ProteinID: XP_009125966
Position
A2
AA seq 406 aa
MAAALQTNTRLNPINVVPGRSLTNPSRAPCRVRCAAASPGKKRFNIALLPGDGIGPEVIS
VAKNVLQQAGSLEGLEFNFQEMPVGGAALDLVGVPLPEESFAAAKQSDAILLGAIGGYKW
DNNEKHLRPEMALFYLRRDLKVFANLRPATVLPQLVDASTLKREVAEGVDMMIVRELTGG
IYFGEPRGIKTNENGEEVGFNTEFYAAHEIDRIARVAFETARKRRGKLCSVDKANVLDAS
ILWRRRVTALASEYPDVELTHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLGVSGPGLFEPIHGSAPDIAGQDKANPLATVLSAAMLLKYGLGEEKAAKRI
EDAVLDTLNKGFRTGDIYSPGNKLVGCKEMGEEVLKSVDSKVTATV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcagctttacaaacgaacacacggttgaatccgatcaatgtcgtcccaggtaga
tctctcaccaatccctctcgcgcgccgtgtagagtaaggtgcgccgccgcttcaccgggg
aagaaacggtttaacatcgctctccttcccggcgatgggattggtccggaagtcatctcc
gtcgccaagaacgtgcttcaacaagctggatctctcgaaggactggagtttaatttccag
gagatgcctgtcggaggagcagctttggatttggtcggagtgcccttgccggaggaatcc
tttgcagctgctaaacaatctgatgccatacttcttggagctatcggagggtacaaatgg
gacaacaatgagaaacatctgagacctgagatggctctgttttaccttcgtagagatctc
aaagtctttgcaaacctcagacctgctactgttttgcctcagctagttgatgcttccacc
ttgaagagagaagtggcagaaggtgttgatatgatgattgtaagggagcttacaggaggt
atctactttggagagccaaggggaatcaagaccaacgaaaatggcgaagaagtcggcttt
aatacagagttctacgctgctcatgagattgatagaattgctcgtgttgcgttcgagact
gctaggaaacggcgtggcaagctgtgttctgtcgacaaagccaatgtgttggatgcatca
atattgtggaggagaagagtaacagcgttagcctctgagtatccagacgttgaactaaca
catatgtatgtcgacaatgctgcaatgcagcttattcgtgaccccaaacagtttgacaca
atagtcaccaataacatttttggtgatatattgtctgatgaggcttcaatgatcactgga
agcattgggatgcttccatctgctagtctcggtgtatcgggacctggactgtttgagcct
atacatggttcagcaccagatatagctggtcaggacaaggcaaacccattggccaccgtt
ctcagcgctgcaatgcttctgaaatatggacttggagaagaaaaggctgcaaagaggatc
gaagacgcggtgttggatactttgaacaaagggtttagaaccggtgacatctactcccct
ggaaataaactggtgggatgcaaggagatgggtgaggaagtgctaaaatcagtggactcc
aaagttacagctactgtttaa

DBGET integrated database retrieval system