KEGG   Brassica rapa (field mustard): 103858582
Entry
103858582         CDS       T03449                                 

Name
(RefSeq) tricyclene synthase, chloroplastic
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00902  Monoterpenoid biosynthesis
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    103858582
Enzymes [BR:brp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     103858582
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 IBN_N
Other DBs
NCBI-GeneID: 103858582
NCBI-ProteinID: XP_033142071
Position
A3
AA seq 421 aa
MASLLQMGSPLIYRNSLVKRIQRPRSFTCTIVAKTTRADESPVVLRRSANYQPSLWDHHH
LLSVENKYTKDESVHERDLLKENVRKMLNDERTTHLEQLELIDDLQKLGVSYHFEREIDN
ILTFTYHKDRRNFVEYDMEYDLHATALEFRLLRQHGFNVPEDVFDVFMENCGKFDSHDIN
GLLSLYEASYLSTKSDTKLQKNVRVFATQQLKNFVDTHGSKDLASCDVEMVVQALDMPYH
WRMGRLATRWYIDMYGKRLHKNPMLLEFSKLDFNIVQAVYQEELKYVSSWWRETGLANQL
HFSRDRIVENYFWTTGQIQEPQFGNVRRIITKVNALLTTIDDIYDIYGTLEELQLFTAAF
ENWDVNRLDDLPEYMRLCFLVVYNEVNNIGCDILRNKDINVIPFLKKSVSIYQLSLFWIF
C
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggctagtctactgcagatgggttcacctcttatttacaggaatagccttgtgaagcga
atccaacgtcctcggtctttcacttgcaccatagtagccaaaacaacaagggccgatgag
tctccagttgtgcttcgtcgttccgcaaactatcagccttctctttgggaccatcaccac
ctcctctcggtcgagaataaatatacgaaagatgaaagtgtgcatgagagagatttgttg
aaagaaaatgtgaggaagatgctcaatgacgagaggaccactcatctcgaacaattggag
ctcattgacgatctgcaaaaactaggcgtttcttaccattttgaacgggaaatcgacaat
attttgacgtttacttatcacaaagatagaagaaacttcgtggagtatgacatggaatac
gatctacatgctactgcactcgaattccgactgctcagacaacatggtttcaatgttcca
gaagatgtatttgatgttttcatggaaaactgtggaaagtttgacagccatgatataaat
ggcctcttatctctgtacgaggcgtcatatctttcaacaaaatcggacactaaactgcaa
aaaaacgttagagtttttgcaacacaacaactcaaaaactttgttgatactcatggtagt
aaagatcttgcatcctgtgatgtggagatggtggtccaagcgttagatatgccatatcat
tggcgaatgggaaggctagccacgagatggtacatagatatgtatggaaagagacttcac
aagaaccctatgttacttgaattctccaagctcgatttcaatatcgtacaagctgtttat
caagaagaactcaaatacgtttccagctggtggagggagacaggtttagctaatcaactt
cacttttcaagagataggatagtggagaattatttttggactactggacaaatccaagag
cctcaatttgggaatgttagacgaataataaccaaagtaaatgcacttcttacaactatc
gatgacatctacgatatctatggcactcttgaagaacttcaactcttcactgccgccttt
gaaaattgggatgtgaatcgtcttgatgacctccccgagtacatgaggttgtgttttctt
gttgtttacaatgaagtaaataacattggatgtgatatcctcagaaataaagatatcaac
gtgattcctttcctcaaaaagtctgtaagtatataccaattatctttgttttggatattt
tgttaa

DBGET integrated database retrieval system