KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_19950
Entry
BSU6051_19950     CDS       T02503                                 
Symbol
sspC
Name
(GenBank) small acid-soluble spore protein alpha/beta-type SASP, SPbeta phage protein SspC
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU6051_19950 (sspC)
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: AGG61385
Position
2156238..2156456
AA seq 72 aa
MAQQSRSRSNNNNDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLV
RLAQQNMGGQFH
NT seq 219 nt   +upstreamnt  +downstreamnt
atggctcaacaaagtagatcaagatcaaacaacaataatgatttactaattcctcaagca
gcttcagctattgaacaaatgaaacttgaaatagcttctgagtttggtgttcaattaggc
gctgagactacatctcgtgcaaacggttcagttggtggagaaatcactaaacgtttagtt
cgcttagctcaacaaaacatgggcggtcaatttcattaa

DBGET integrated database retrieval system