KEGG   Bacillus sonorensis: S101395_02732
Entry
S101395_02732     CDS       T06571                                 
Name
(GenBank) Small, acid-soluble spore protein
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bson  Bacillus sonorensis
Brite
KEGG Orthology (KO) [BR:bson00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    S101395_02732
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: ASB89239
Position
2546027..2546227
AA seq 66 aa
MARNNNNELLIPNAQSAIEQMKLEIAQEFGVQLGAETTSRANGSVGGEITKRLVQMAQQQ
MGGQLH
NT seq 201 nt   +upstreamnt  +downstreamnt
atggcacgcaacaataataatgaattacttattccaaatgctcagtcagctattgaacaa
atgaagcttgaaatagctcaagagtttggtgttcaattaggtgcagagactacttcaaga
gcaaatggttcagttggtggagaaattactaaacgtcttgttcaaatggctcaacaacaa
atgggtggacaattacattaa

DBGET integrated database retrieval system