KEGG   Bacillus subtilis QB928: B657_19950
Entry
B657_19950        CDS       T02292                                 
Symbol
sspC
Name
(GenBank) Small acid-soluble spore protein (alpha/beta-typeSASP)
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bsq  Bacillus subtilis QB928
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    B657_19950 (sspC)
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: AFQ57939
Position
2135725..2135952
AA seq 75 aa
MNKMAQQSRSRSNNNNDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITK
RLVRLAQQNMGGQFH
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaataagatggctcaacaaagtagatcaagatcaaacaacaataatgatttactaatt
cctcaagcagcttcagctattgaacaaatgaaacttgaaatagcttctgagtttggtgtt
caattaggcgctgagactacatctcgtgcaaacggttcagttggtggagaaatcactaaa
cgtttagttcgcttagctcaacaaaacatgggcggtcaatttcattaa

DBGET integrated database retrieval system