KEGG   Bacillus subtilis subsp. subtilis 168: BSU00210
Entry
BSU00210          CDS       T00010                                 

Symbol
recR
Name
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU00210 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU00210 (recR)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU00210 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BSU00210 (recR)
SSDB
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 Zn_ribbon_17 HHH_8 PI3_PI4_kinase
Other DBs
NCBI-GeneID: 937197
NCBI-ProteinID: NP_387902
Pasteur: BG10085
BSORF: BG10085
UniProt: P24277 A0A6M4JDW2
Position
28867..29463
AA seq 198 aa
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcaatatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagatgtagta
ttagattttgcgaaagcattagtaaatgcgaaacgcaacctgacatattgttcagtttgc
gggcatattacagatcaggacccttgctatatatgtgaagatacgcgcagggataagtct
gttatctgtgttgtgcaagaccctaaagacgttatcgctatggagaaaatgaaggaatac
aacggacagtatcacgttcttcacggcgctatttctccaatggacggcatcggaccggag
gatattaaaataccagaattgttaaaacgattacaggatgatcaagtgacagaagtgatc
ctcgcgacaaaccctaatatagaaggggaagcaacagcgatgtatatatcaaggctcctc
aagccgtctggtattaagctctcccgtattgcccacggactgcccgtcggcggtgatttg
gaatatgctgatgaggtcactctttctaaagcacttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system