KEGG   Bacillus subtilis subsp. subtilis 168: BSU00520
Entry
BSU00520          CDS       T00010                                 

Symbol
ctc
Name
(RefSeq) 50S ribosomal protein L25/general stress protein Ctc
  KO
K02897  large subunit ribosomal protein L25
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU00520 (ctc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU00520 (ctc)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    BSU00520 (ctc)
SSDB
Motif
Pfam: Ribosomal_TL5_C Ribosomal_L25p RNA_pol_A_bac
Other DBs
NCBI-GeneID: 936984
NCBI-ProteinID: NP_387933
Pasteur: BG10115
BSORF: BG10115
UniProt: P14194 A0A6M3ZBP3
Position
58783..59397
AA seq 204 aa
MATLTAKERTDFTRSSLRNIRTSGHVPGIIYGKDTGNKPVSLDSVELIKTLRDEGKNAVI
TLEVSGEKHSVMVTDLQTDPLKNEITHADFQVVNMSEDIEVEVPIHLTGEAIGVKNGGVL
QQPLYALTVKAKPKAIPQTIEADISSLDVNEVLTIADLPAGGDYSFNHESDEVVASILPP
QQQEAAEVDEEESADAQPEGENEQ
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcaactttaacggcaaaagaaagaacggactttactcgttcgtctcttcggaatatc
cgtacttcaggacatgttccaggtatcatatatgggaaggatacgggtaacaaacctgtg
tcattagacagtgtggagctcatcaaaacgctgagggacgaaggcaaaaatgcagtcatt
acgcttgaggtcagcggagaaaaacactcagtcatggtaacagacctgcagacggacccg
ctgaaaaatgaaatcactcatgctgattttcaagtagttaatatgagtgaggacattgaa
gtggaagttccgattcatctgaccggagaagccattggagtgaaaaacggaggcgtactg
cagcagccgttatatgcacttactgtaaaggccaagccaaaagccattccgcaaacgatt
gaggctgatatttcaagcctcgatgtaaatgaagtactgacgattgcggatttgcctgct
ggcggtgactactcctttaatcatgaatcagatgaggttgtggcttcaatccttcctccg
cagcagcaggaagcagctgaggtcgatgaagaggaatctgccgatgctcagcctgaaggt
gaaaacgaacaataa

DBGET integrated database retrieval system