KEGG   Bacillus subtilis subsp. subtilis 168: BSU00700
Entry
BSU00700          CDS       T00010                                 

Gene name
coaX
Definition
(RefSeq) type III pantothenate kinase
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU00700 (coaX)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     BSU00700 (coaX)
SSDB
Motif
Pfam: Pan_kinase
Other DBs
NCBI-GeneID: 936960
NCBI-ProteinID: NP_387951
Pasteur: BG10133
BSORF: BG10133
UniProt: P37564
Position
79092..79868
AA seq 258 aa
MLLVIDVGNTNTVLGVYHDGKLEYHWRIETSRHKTEDEFGMILRSLFDHSGLMFEQIDGI
IISSVVPPIMFALERMCTKYFHIEPQIVGPGMKTGLNIKYDNPKEVGADRIVNAVAAIHL
YGNPLIVVDFGTATTYCYIDENKQYMGGAIAPGITISTEALYSRAAKLPRIEITRPDNII
GKNTVSAMQSGILFGYVGQVEGIVKRMKWQAKQEPKVIATGGLAPLIANESDCIDIVDPF
LTLKGLELIYERNRVGSV
NT seq 777 nt   +upstreamnt  +downstreamnt
ttgttactggttatcgatgtggggaacaccaatactgtacttggtgtatatcatgatgga
aaattagaatatcactggcgtatagaaacaagcaggcataaaacagaagatgagtttggg
atgattttgcgctccttatttgatcactccgggcttatgtttgaacagatagatggcatt
attatttcgtcagtagtgccgccaatcatgtttgcgttagaaagaatgtgcacaaaatac
tttcatatcgagcctcaaattgttggtccaggtatgaaaaccggtttaaatataaaatat
gacaatccgaaagaagtaggggcagacagaatcgtaaatgctgtcgctgcgatacacttg
tacggcaatccattaattgttgtcgatttcggaaccgccacaacgtactgctatattgat
gaaaacaaacaatacatgggcggggcgattgcccctgggattacaatttcgacagaggcg
ctttactcgcgtgcagcaaagcttcctcgtatcgaaatcacccggcccgacaatattatc
ggaaaaaacactgttagcgcgatgcaatctggaattttatttggctatgtcggccaagtg
gaaggaatcgttaagcgaatgaaatggcaggcaaaacaggaaccaaaggtcattgcgaca
ggaggcctggcgccgctcattgcgaacgaatcagattgtatagacatcgttgatccattc
ttaaccctaaaagggctggaattgatttatgaaagaaaccgcgtaggaagtgtatag

KEGG   Bacillus subtilis subsp. subtilis 168: BSU23760
Entry
BSU23760          CDS       T00010                                 

Gene name
coaA
Definition
(RefSeq) pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU23760 (coaA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     BSU23760 (coaA)
SSDB
Motif
Pfam: PRK AAA_18 CoaE
Other DBs
NCBI-GeneID: 938704
NCBI-ProteinID: NP_390257
Pasteur: BG11748
BSORF: BG11748
UniProt: P54556 A0A6M4JKH1
Position
complement(2468549..2469508)
AA seq 319 aa
MKNKELNLHTLYTQHNRESWSGFGGHLSIAVSEEEAKAVEGLNDYLSVEEVETIYIPLVR
LLHLHVKSAAERNKHVNVFLKHPHSAKIPFIIGIAGSVAVGKSTTARILQKLLSRLPDRP
KVSLITTDGFLFPTAELKKKNMMSRKGFPESYDVKALLEFLNDLKSGKDSVKAPVYSHLT
YDREEGVFEVVEQADIVIIEGINVLQSPTLEDDRENPRIFVSDFFDFSIYVDAEESRIFT
WYLERFRLLRETAFQNPDSYFHKFKDLSDQEADEMAASIWESVNRPNLYENILPTKFRSD
LILRKGDGHKVEEVLVRRV
NT seq 960 nt   +upstreamnt  +downstreamnt
gtgaaaaataaagaacttaacctacatactttatatacacagcacaatcgggagtcttgg
tctggttttggggggcatttgtcgattgctgtatctgaagaagaggcaaaagctgtggaa
ggattgaatgattatctatctgttgaagaagtggagacgatctatattccgcttgttcgc
ttgcttcatttacatgtcaagtctgcggctgaacgcaataagcatgtcaatgtttttttg
aagcacccacattcagccaaaattccgtttattatcggcattgccggcagtgtcgcagtc
ggaaaaagcacgacggcgcggatcttgcagaagctgctttcgcgtttgcctgaccgtcca
aaagtgagccttatcacgacagatggttttttatttcctactgccgagctgaaaaagaaa
aatatgatgtcaagaaaaggatttcctgaaagctatgatgtaaaggcgctgctcgaattt
ttgaatgacttaaaatcaggaaaggacagcgtaaaggccccggtgtattcccatctaacc
tatgaccgcgaggaaggtgtgttcgaggttgtagaacaggcggatattgtgattattgaa
ggcattaatgttcttcagtcgcccaccttggaggatgaccgggaaaacccgcgtattttt
gtttccgatttctttgatttttcgatttatgtggatgcggaggaaagccggattttcact
tggtatttagagcgttttcgcctgcttcgggaaacagcttttcaaaatcctgattcatat
tttcataaatttaaagacttgtccgatcaggaggctgacgagatggcagcctcgatttgg
gagagtgtcaaccggccgaatttatatgaaaatattttgccaactaaattcaggtcagat
ctcattttgcgtaagggagacgggcataaggtcgaggaagtgttggtaaggagggtatga

DBGET integrated database retrieval system