KEGG   Bacillus subtilis subsp. subtilis 168: BSU00920
Entry
BSU00920          CDS       T00010                                 

Symbol
gltX
Name
(RefSeq) glutamate--tRNA ligase
  KO
K09698  nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU00920 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU00920 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU00920 (gltX)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     BSU00920 (gltX)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BSU00920 (gltX)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU00920 (gltX)
SSDB
Motif
Pfam: tRNA-synt_1c Anticodon_2 VMAP-M5
Other DBs
NCBI-GeneID: 936862
NCBI-ProteinID: NP_387973
Pasteur: BG10154
BSORF: BG10154
UniProt: P22250 A0A6M4JC62
Position
111047..112498
AA seq 483 aa
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL
NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE
EQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKVIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWSPVGEEELFTKEQF
IEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAKAVLEEEQVPEVLSTFAAKLEE
LEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETAIQRL
KNI
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgggaaacgaagtacgcgtccgttatgcaccgagtccaaccggacatttgcatattgga
aatgccagaacggcgctttttaattatttatttgcccgcaatcaaggcggtaagtttatc
attcgagttgaggatactgataaaaagcgcaatattgagggcggagaacaaagccagctg
aattatctgaagtggctaggtattgactgggatgagagtgtggatgtcggaggagagtac
ggtccataccgtcagtcagagcgtaacgatatctataaagtgtactatgaagagcttctt
gaaaaagggcttgcttataaatgttactgtacggaagaagagcttgaaaaagagcgtgaa
gaacagattgcccgcggagaaatgcctcgttattccggaaaacacagagacctgactcag
gaagaacaggagaaatttatcgccgaaggcagaaaaccaagtattcgtttccgtgtgccg
gaaggaaaagtcatcgccttcaacgacatcgtaaaaggcgaaatttcttttgaatcagat
ggcatcggcgacttcgttattgtgaaaaaggacggaacgcctacttataacttcgcggta
gctattgatgactacttaatgaaaatgacacacgtgctgcgcggtgaggatcatatttct
aacacaccgaaacagattatgatctatcaagcattcgggtgggatattcctcagttcgga
cacatgacgctgattgtaaacgaaagccgtaaaaagctcagcaaacgtgatgaatccatt
attcaattcatcgagcagtacaaagagcttggctacctgccagaagcgctgttcaacttt
atcggcttgttaggctggtcaccggttggagaagaagagcttttcacaaaagagcagttt
attgaaatttttgatgtaaatcgtttatctaaatcaccagctttgtttgatatgcataag
ctaaaatgggttaacaaccaatatgtgaagaagctggatcttgatcaggttgttgaactg
acgcttccgcatttgcaaaaagccggcaaagttggcactgagctttctgctgaagaacaa
gaatgggttcgtaaactgatttccctgtatcatgagcaattaagctacggtgcggaaatt
gttgagctgactgatttgttctttacggatgagatcgagtataatcaagaagcgaaagct
gttctggaagaagaacaggttcctgaagtgctcagcacattcgcagcgaagcttgaagag
cttgaggagttcactccggataatatcaaagcatcgatcaaagcagtgcagaaagaaact
ggccataaagggaaaaaactgtttatgccgattcgtgttgctgtaacagggcaaactcac
ggtccggaactgccgcaatcaattgaattgatcggtaaagagactgcaattcagcgttta
aagaatatctaa

DBGET integrated database retrieval system