KEGG   Bacillus subtilis subsp. subtilis 168: BSU00990
Entry
BSU00990          CDS       T00010                                 

Symbol
rpmG
Name
(RefSeq) 50S ribosomal protein L33
  KO
K02913  large subunit ribosomal protein L33
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU00990 (rpmG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU00990 (rpmG)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU00990 (rpmG)
  Bacteria
    BSU00990 (rpmG)
SSDB
Motif
Pfam: Ribosomal_L33 HypA zf-LITAF-like DUF5066 Ribosomal_L37e Cas_CXXC_CXXC DUF6315
Other DBs
NCBI-GeneID: 936842
NCBI-ProteinID: NP_387980
Pasteur: BG10160
BSORF: BG10160
UniProt: Q06798 A0A6M3Z6S3
Position
117349..117498
AA seq 49 aa
MRKKITLACKTCGNRNYTTMKSSASAAERLEVKKYCSTCNSHTAHLETK
NT seq 150 nt   +upstreamnt  +downstreamnt
atgagaaaaaagattacgttagcatgcaagacatgcggaaaccgtaattatacgacaatg
aagagctctgcatcagcggctgagcgattagaagtaaagaaatactgcagtacttgcaat
tcacatacagctcatcttgaaacaaaatag

KEGG   Bacillus subtilis subsp. subtilis 168: BSU24900
Entry
BSU24900          CDS       T00010                                 

Symbol
rpmG
Name
(RefSeq) 50S ribosomal protein L33
  KO
K02913  large subunit ribosomal protein L33
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU24900 (rpmG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU24900 (rpmG)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU24900 (rpmG)
  Bacteria
    BSU24900 (rpmG)
SSDB
Motif
Pfam: Ribosomal_L33
Other DBs
NCBI-GeneID: 937959
NCBI-ProteinID: NP_570908
Pasteur: BG14180
BSORF: BG14180
UniProt: P56849 A0A6M4JMD8
Position
complement(2574408..2574557)
AA seq 49 aa
MRVNITLACTECGERNYISKKNKRNNPDRVEFKKYCPRDKKSTLHRETK
NT seq 150 nt   +upstreamnt  +downstreamnt
atgcgcgttaatattactttggcttgcactgaatgtggtgagcgtaactatatttctaaa
aagaacaaacgcaacaatccagaccgcgttgaatttaaaaaatattgcccacgtgataaa
aaatctacgttacaccgtgaaacaaaataa

DBGET integrated database retrieval system