KEGG   Bacillus subtilis subsp. subtilis 168: BSU01100
Entry
BSU01100          CDS       T00010                                 

Symbol
rpsL
Name
(RefSeq) 30S ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01100 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01100 (rpsL)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU01100 (rpsL)
  Bacteria
    BSU01100 (rpsL)
  Archaea
    BSU01100 (rpsL)
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-GeneID: 936616
NCBI-ProteinID: NP_387991
Pasteur: BG19009
BSORF: BG19009
UniProt: P21472 A0A6M3Z6L4
Position
129702..130118
AA seq 138 aa
MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNS
ALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGV
ENRAQGRSKYGTKKPKAK
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcctacaattaatcagctaattcgcaaaggacgcgtgagtaaagtagaaaactcaaag
tctcctgcacttaacaaaggatacaacagctttaaaaaagagcacactaacgtatcttct
ccacaaaaacgcggggtatgtactcgtgttggtacaatgacaccgaaaaaaccgaactca
gcacttcgtaaatatgctcgtgttcgtttgactaacggaatcgaggttactgcttacatt
cctggtatcggtcacaacctgcaagagcacagtgttgtacttatccgcggcggacgtgta
aaagacttaccaggggtacgttaccacatcgttcgtggtgcgcttgatactgctggagtt
gaaaaccgtgcacaaggccgttctaaatacggtacgaaaaaacctaaagcaaaataa

DBGET integrated database retrieval system