KEGG   Bacillus subtilis subsp. subtilis 168: BSU01110
Entry
BSU01110          CDS       T00010                                 

Symbol
rpsG
Name
(RefSeq) 30S ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01110 (rpsG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01110 (rpsG)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU01110 (rpsG)
  Bacteria
    BSU01110 (rpsG)
  Archaea
    BSU01110 (rpsG)
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 935997
NCBI-ProteinID: NP_387992
Pasteur: BG19006
BSORF: BG19006
UniProt: P21469 A0A6M3Z6J8
Position
130160..130630
AA seq 156 aa
MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYKSFDIIKERTGNDAME
VFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERL
ANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW
NT seq 471 nt   +upstreamnt  +downstreamnt
atgccacgtaaaggtcctgtagcaaaaagagatgttttacctgatccgatttacaactct
aagcttgtatctcgtttaatcaacaaaatgatgatcgatggtaaaaaaggtaagtctcaa
acgatcctatacaagtcattcgatatcattaaagaacgtactggcaatgatgcaatggag
gttttcgaacaagcattgaaaaacatcatgcctgtacttgaagtaaaagcacgccgtgta
ggtggtgcgaactaccaagttcctgtagaagttcgtcctgaacgtcgtacgactcttgga
cttcgctggttagttaactacgctcgtcttcgtggagaaaaaacgatggaagagcgttta
gctaacgaaatccttgacgcagctaacaacactggtgctgctgttaagaaacgtgaagac
actcataagatggctgaagcaaacaaagcatttgctcactatcgctggtag

DBGET integrated database retrieval system