KEGG   Bacillus subtilis subsp. subtilis 168: BSU01150
Entry
BSU01150          CDS       T00010                                 

Symbol
rpsJ
Name
(RefSeq) 30S ribosomal protein S10
  KO
K02946  small subunit ribosomal protein S10
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01150 (rpsJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01150 (rpsJ)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU01150 (rpsJ)
  Bacteria
    BSU01150 (rpsJ)
  Archaea
    BSU01150 (rpsJ)
SSDB
Motif
Pfam: Ribosomal_S10 DUF384 PriA_C
Other DBs
NCBI-GeneID: 936825
NCBI-ProteinID: NP_387996
Pasteur: BG19008
BSORF: BG19008
UniProt: P21471 A0A6M3Z773
Position
135364..135672
AA seq 102 aa
MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVHKYKD
SREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL
NT seq 309 nt   +upstreamnt  +downstreamnt
atggcaaaacaaaaaattcgtattcgtttgaaagcatatgatcatagaatccttgatcaa
tctgcagagaagattgttgaaacggcaaaacgttctggtgccagcgtatctggtccgatt
ccgttgccaactgaaaaatcagtttacacaatccttcgtgcggtgcacaaatacaaagat
tctcgtgagcaatttgaaatgcgtacacataaacgtttaatcgacattgtgaacccaaca
ccacaaactgttgatgctcttatgcgattagacttaccatctggtgtcgatatcgaaatt
aaactttaa

DBGET integrated database retrieval system