KEGG   Bacillus subtilis subsp. subtilis 168: BSU01180
Entry
BSU01180          CDS       T00010                                 

Symbol
rplW
Name
(RefSeq) 50S ribosomal protein L23
  KO
K02892  large subunit ribosomal protein L23
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01180 (rplW)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01180 (rplW)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01180 (rplW)
  Bacteria
    BSU01180 (rplW)
  Archaea
    BSU01180 (rplW)
SSDB
Motif
Pfam: Ribosomal_L23
Other DBs
NCBI-GeneID: 936820
NCBI-ProteinID: NP_387999
Pasteur: BG11221
BSORF: BG11221
UniProt: P42924 A0A6M3Z6Q4
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
136992..137279
AA seq 95 aa
MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKVDKVNIMNYK
GKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaaagatcctcgtgatgttctaaagcgccccgtcattactgaacgttctgccgattta
atgactgaaaaaaaatatacttttgaagttgatgtaagagctaacaaaacagaagtgaaa
gacgcggttgaaagcatctttggagtgaaagttgacaaagtcaacatcatgaactacaaa
ggcaaatcaaaacgtgttggacgctacactggtatgactagccgtcgcagaaaagcgatc
gtaaaacttactgcagacagcaaagaaatcgaaatttttgaagcttaa

DBGET integrated database retrieval system