KEGG   Bacillus subtilis subsp. subtilis 168: BSU01190
Entry
BSU01190          CDS       T00010                                 

Symbol
rplB
Name
(RefSeq) 50S ribosomal protein L2
  KO
K02886  large subunit ribosomal protein L2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01190 (rplB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01190 (rplB)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01190 (rplB)
  Bacteria
    BSU01190 (rplB)
  Archaea
    BSU01190 (rplB)
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 936817
NCBI-ProteinID: NP_388000
Pasteur: BG11217
BSORF: BG11217
UniProt: P42919 A0A6M3Z6U0
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
137311..138144
AA seq 277 aa
MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTVRHQGGGHKR
QYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYILAPKGIQVGTEIMSGP
EADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQVLGKEGKYVLVRLNSGE
VRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAP
IGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcgattaaaaagtataaaccgacctctaatggacgtcgtggcatgacaacttcagat
tttgctgaaatcacgactgacaagccggaaaaatccttgcttgctccccttcacaaaaaa
ggcggacgtaacaaccaaggtaaattgactgtacgtcaccaaggtggcggacataaacgc
caataccgtgttatcgacttcaaacgcgataaagatggtatacctggacgcgttgctaca
gttgaatacgatccaaaccgttcagctaacatcgctctaatcaactatgcagacggagaa
aaacgttacattcttgctcctaaaggaattcaagtaggtactgaaatcatgtcaggtcct
gaagctgacattaaagtaggtaatgcacttccacttatcaacatccctgttggtacagtt
gtgcataacattgaattaaaacctggtaaaggcggacagcttgtacgttcagctggtaca
tctgctcaggttcttggtaaagaaggtaaatacgttcttgtacgtcttaactctggtgaa
gttcgcatgatcctttctgcttgccgtgcttctatcggtcaagtaggtaacgaacagcac
gaacttatcaacattggtaaagctggacgttctcgctggaaaggcatccgtcctacagtt
cgtggttctgtaatgaaccctaacgatcacccacacggtggtggtgaaggacgtgcgcca
atcggacgtaaatcaccaatgtctccatggggcaaaccaactcttggattcaagactcgt
aagaaaaagaacaaatccgataaatttatcgtacgtcgtcgtaaaaataaataa

DBGET integrated database retrieval system