KEGG   Bacillus subtilis subsp. subtilis 168: BSU01210
Entry
BSU01210          CDS       T00010                                 

Symbol
rplV
Name
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01210 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01210 (rplV)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01210 (rplV)
  Bacteria
    BSU01210 (rplV)
  Archaea
    BSU01210 (rplV)
SSDB
Motif
Pfam: Ribosomal_L22
Other DBs
NCBI-GeneID: 938123
NCBI-ProteinID: NP_388002
Pasteur: BG11078
BSORF: BG11078
UniProt: P42060 A0A6M4JC36
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
138497..138838
AA seq 113 aa
MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEH
NYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG
NT seq 342 nt   +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaacagtccgtattgctcctcgtaaagcacgtctagta
atggacctgattcgaggcaagcaagtaggtgaggcagtatcaatcttgaaccttacacca
agagctgcttctccaattatcgagaaagtattaaaatccgctattgcaaatgctgagcat
aactatgaaatggacgctaacaacctggttatttctcaagcattcgttgacgaaggccct
acgttaaaaagattccgcccacgtgctatgggacgtgcgagccaaatcaacaaacgtacg
agccacattacaatcgttgtatcagaaaagaaggagggataa

DBGET integrated database retrieval system