KEGG   Bacillus subtilis subsp. subtilis 168: BSU01220
Entry
BSU01220          CDS       T00010                                 

Symbol
rpsC
Name
(RefSeq) 30S ribosomal protein S3
  KO
K02982  small subunit ribosomal protein S3
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01220 (rpsC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01220 (rpsC)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    BSU01220 (rpsC)
  Archaea
    BSU01220 (rpsC)
SSDB
Motif
Pfam: Ribosomal_S3_C KH_2 KH_4 VAR1 KH_5 DNA_pol3_a_NI LeuA_dimer TRAM
Other DBs
NCBI-GeneID: 936808
NCBI-ProteinID: NP_388003
Pasteur: BG19005
BSORF: BG19005
UniProt: P21465 A0A6M4JC90
Position
138842..139498
AA seq 218 aa
MGQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREYISKRLSDASVSKVEIERAA
NRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVADNIA
RQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARSEYYSEGTVPLHTLRAD
IDYATSEADTTYGKLGVKVWIYRGEVLPTKKKNEEGGK
NT seq 657 nt   +upstreamnt  +downstreamnt
gtgggtcaaaaggtaaatccagtcggtcttcgtatcggagtcattcgtgattgggaatct
aagtggtacgctggtaaagattacgctgacttcctgcacgaagatttaaaaattcgtgaa
tacattagcaaacgcctttctgacgcttctgtttctaaagtagaaattgagcgtgcagca
aaccgcgttaacattacgatccacacagctaagcctggtatggttatcggtaaaggcggt
tctgaagtcgaagcacttcgcaaagcccttaacagccttactggcaagcgtgtacacatt
aacattcttgaaatcaaaagagcagatcttgatgcacagctagttgctgacaacatcgct
cgtcaattagaaaaccgtgtttctttccgccgtgcgcagaaacaacaaatccaacgtact
atgcgtgctggagcacaaggtgtgaaaacaatggtttctggtcgtcttggcggtgcagat
atcgctcgttctgaatactacagtgaaggaactgttccattgcacacattacgtgcggac
attgactatgcaacatctgaagctgatactacttacggtaagcttggtgtaaaagtctgg
atctatcgtggagaggttcttcctactaagaagaaaaatgaggaaggaggaaaataa

DBGET integrated database retrieval system