KEGG   Bacillus subtilis subsp. subtilis 168: BSU01250
Entry
BSU01250          CDS       T00010                                 

Symbol
rpsQ
Name
(RefSeq) 30S ribosomal protein S17
  KO
K02961  small subunit ribosomal protein S17
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01250 (rpsQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01250 (rpsQ)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU01250 (rpsQ)
  Bacteria
    BSU01250 (rpsQ)
  Archaea
    BSU01250 (rpsQ)
SSDB
Motif
Pfam: Ribosomal_S17
Other DBs
NCBI-GeneID: 936805
NCBI-ProteinID: NP_388006
Pasteur: BG10757
BSORF: BG10757
UniProt: P12874 A0A6M3Z785
Position
140147..140410
AA seq 87 aa
MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKKFKAHDENNQAKIGDI
VKIMETRPLSATKRFRLVEVVEEAVII
NT seq 264 nt   +upstreamnt  +downstreamnt
atgagcgaacgtaaccaacgcaaagtttaccaaggccgtgttgtttctgacaaaatggat
aaaaccattactgttgttgttgagacatacaaaaaacatacactttacggtaaacgcgta
aaatactcaaaaaaattcaaagcacatgatgaaaataatcaagctaaaatcggtgacatc
gttaagatcatggaaactcgtccattgtctgcaactaagcgtttccgtctagttgaagtt
gtcgaagaagctgttattatctaa

DBGET integrated database retrieval system