KEGG   Bacillus subtilis subsp. subtilis 168: BSU01260
Entry
BSU01260          CDS       T00010                                 

Symbol
rplN
Name
(RefSeq) 50S ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01260 (rplN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01260 (rplN)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01260 (rplN)
  Bacteria
    BSU01260 (rplN)
  Archaea
    BSU01260 (rplN)
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-GeneID: 935939
NCBI-ProteinID: NP_388007
Pasteur: BG10758
BSORF: BG10758
UniProt: P12875 A0A6M3Z786
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
140451..140819
AA seq 122 aa
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPGGVVKKGEVVKA
VIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVARELRENNFMKIVSLAPE
VI
NT seq 369 nt   +upstreamnt  +downstreamnt
atgattcaacaagagactcgtttaaaagtagctgacaactctggcgcacgtgaagtactt
actattaaagttcttggtggttctggacgtaaaacagctaacattggtgatgtaattgtt
tgcacggttaaacaagcaacaccaggaggcgttgtcaaaaaaggtgaagtcgtaaaagct
gttatcgttcgcactaaaagcggagcgcgcagaagtgacggttcatacatcagcttcgat
gagaatgcatgtgttatcatccgtgacgacaagagcccacgcggaactcgtatcttcgga
ccagttgctcgtgaattgcgtgaaaacaactttatgaaaattgtttctctagctccagaa
gttatctaa

DBGET integrated database retrieval system