KEGG   Bacillus subtilis subsp. subtilis 168: BSU01270
Entry
BSU01270          CDS       T00010                                 

Symbol
rplX
Name
(RefSeq) 50S ribosomal protein L24
  KO
K02895  large subunit ribosomal protein L24
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01270 (rplX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01270 (rplX)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01270 (rplX)
  Bacteria
    BSU01270 (rplX)
  Archaea
    BSU01270 (rplX)
SSDB
Motif
Pfam: ribosomal_L24 KOW
Other DBs
NCBI-GeneID: 936799
NCBI-ProteinID: NP_388008
Pasteur: BG10759
BSORF: BG10759
UniProt: P0CI78 A0A6M4JF23
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
140857..141168
AA seq 103 aa
MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANPQGGISNQE
APIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK
NT seq 312 nt   +upstreamnt  +downstreamnt
atgcatgtaaaaaaaggcgataaagttatggttatctctggtaaagataaaggcaaacaa
ggaacaatccttgctgctttccctaaaaaggaccgcgttttagttgaaggtgttaacatg
gtaaagaaacactctaaaccaactcaagctaaccctcaaggcggtatttctaatcaagag
gcgccaattcatgtatcaaacgttatgccgctcgatcctaaaacaggtgaagtgactcgc
gtaggatacaaagtggaagatggcaaaaaagttcgtgtagcaaaaaaatctgggcaagtt
ctagataaatag

DBGET integrated database retrieval system