KEGG   Bacillus subtilis subsp. subtilis 168: BSU01290
Entry
BSU01290          CDS       T00010                                 

Symbol
rpsN
Name
(RefSeq) 30S ribosomal protein S14
  KO
K02954  small subunit ribosomal protein S14
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01290 (rpsN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01290 (rpsN)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU01290 (rpsN)
  Bacteria
    BSU01290 (rpsN)
  Archaea
    BSU01290 (rpsN)
SSDB
Motif
Pfam: Ribosomal_S14 DUF6011 DZR_2 FYVE
Other DBs
NCBI-GeneID: 935946
NCBI-ProteinID: NP_388010
Pasteur: BG10761
BSORF: BG10761
UniProt: P12878 A0A6M3Z6V1
Position
141757..141942
AA seq 61 aa
MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKAS
W
NT seq 186 nt   +upstreamnt  +downstreamnt
gtggctaaaaagtctatgattgcgaaacaacaacgtacaccaaagtttaaagtacaagag
tacacacgctgtgaacgctgcggacgtccgcattcagtcattcgtaaatttaaactttgc
cgtatttgtttccgtgagcttgcatataaaggacaaattcctggcgtgaaaaaagccagc
tggtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU08880
Entry
BSU08880          CDS       T00010                                 

Symbol
rpsN
Name
(RefSeq) 30S ribosomal protein S14
  KO
K02954  small subunit ribosomal protein S14
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU08880 (rpsN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU08880 (rpsN)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU08880 (rpsN)
  Bacteria
    BSU08880 (rpsN)
  Archaea
    BSU08880 (rpsN)
SSDB
Motif
Pfam: Ribosomal_S14 DUF3073
Other DBs
NCBI-GeneID: 936213
NCBI-ProteinID: NP_388768
Pasteur: BG13085
BSORF: BG13085
UniProt: O31587 A0A6M3ZE09
Position
965909..966178
AA seq 89 aa
MAKKSKVAKELKRQQLVEQYAGIRRELKEKGDYEALSKLPRDSAPGRLHNRCMVTGRPRA
YMRKFKMSRIAFRELAHKGQIPGVKKASW
NT seq 270 nt   +upstreamnt  +downstreamnt
ttggctaaaaaatcaaaagtggcaaaagagttaaaacgccaacagcttgttgagcaatac
gctggtattagacgcgagttgaaggaaaaaggagattacgaggcactcagcaagctgcca
agagattcagcaccgggaaggcttcacaaccgctgcatggtaacggggcgcccgagagca
tatatgaggaagtttaaaatgtccagaatcgctttcagggagctggcccataaaggccag
attcccggtgtgaaaaaagcaagctggtaa

DBGET integrated database retrieval system