KEGG   Bacillus subtilis subsp. subtilis 168: BSU01300
Entry
BSU01300          CDS       T00010                                 

Symbol
rpsH
Name
(RefSeq) 30S ribosomal protein S8
  KO
K02994  small subunit ribosomal protein S8
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01300 (rpsH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01300 (rpsH)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    BSU01300 (rpsH)
  Archaea
    BSU01300 (rpsH)
SSDB
Motif
Pfam: Ribosomal_S8
Other DBs
NCBI-GeneID: 936328
NCBI-ProteinID: NP_388011
Pasteur: BG10762
BSORF: BG10762
UniProt: P12879 A0A6M4JHT7
Position
141974..142372
AA seq 132 aa
MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGFIRDVEFVEDSKQGII
RVFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIAIISTSQGVLTDKEARA
KQAGGEVLAYVW
NT seq 399 nt   +upstreamnt  +downstreamnt
atggttatgacagatccaattgcagatatgctaactcgtattcgcaatgcaaacatggta
cgtcatgagaagcttgaaattcctgcttctaaattgaaaagagaaattgctgaaatttta
aagcgtgaaggtttcattcgtgacgttgagttcgtagaagacagcaaacaaggtattatc
cgcgttttcttgaaatacggacaaaacaacgagcgcgttatcactggtcttaaaagaatc
agcaagcctggtttgcgtgtttatgctaaatctaatgaagtaccccgcgtacttaacggt
cttggaatcgcgattatttctacatcacaaggtgttttaacggacaaagaagcccgtgca
aaacaagctggtggagaagttctagcatacgtttggtaa

DBGET integrated database retrieval system