KEGG   Bacillus subtilis subsp. subtilis 168: BSU01330
Entry
BSU01330          CDS       T00010                                 

Symbol
rpsE
Name
(RefSeq) 30S ribosomal protein S5
  KO
K02988  small subunit ribosomal protein S5
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01330 (rpsE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01330 (rpsE)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU01330 (rpsE)
  Bacteria
    BSU01330 (rpsE)
  Archaea
    BSU01330 (rpsE)
SSDB
Motif
Pfam: Ribosomal_S5 Ribosomal_S5_C PmbA_TldD
Other DBs
NCBI-GeneID: 938012
NCBI-ProteinID: NP_388014
Pasteur: BG10442
BSORF: BG10442
UniProt: P21467 A0A6M4JRE7
Position
143361..143861
AA seq 166 aa
MRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAI
RKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEGTGVIAGGPVRAVLELAGV
ADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVEELLG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgcgtcgtattgacccaagcaaattagagttagaagaacgcttagttacggttaaccgc
gtagcgaaagttgttaaaggtggtcgtcgtttccgcttcgcagctctagtcgttgtcggt
gacaaaaacggacacgtaggattcggtactggtaaagcacaagaagtaccagaagcgatt
cgcaaagctgttgaagatgcgaaaaagaatttgattgaagtaccaatggttggaactaca
attccacacgaaatcatcggacgtttcggtgcaggtaacatcttgttaaaacctgcttct
gaaggtactggagttatcgctggaggccctgtacgtgcggtacttgagctagctggtgta
gctgatatcctttctaagtctttaggttctaacacaccgatcaacatgattcgtgcaaca
cttcaaggtttaagtgaacttaaacgtgctgaagacgttgcgaagcttcgtggaaaatct
gtagaagaactgttaggataa

DBGET integrated database retrieval system